Comparing WP_012384411.1 NCBI__GCF_000019845.1:WP_012384411.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
35% identity, 88% coverage: 2:173/195 of query aligns to 4:171/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
35% identity, 88% coverage: 2:173/195 of query aligns to 4:171/207 of 1h2eA
5hr5A Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
32% identity, 94% coverage: 2:185/195 of query aligns to 226:398/424 of 5hr5A
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
32% identity, 94% coverage: 2:185/195 of query aligns to 222:394/425 of 5htkA
Sites not aligning to the query:
P26285 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Bos taurus (Bovine) (see paper)
32% identity, 94% coverage: 2:185/195 of query aligns to 253:425/531 of P26285
Sites not aligning to the query:
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
32% identity, 94% coverage: 2:185/195 of query aligns to 252:424/505 of O60825
Sites not aligning to the query:
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
31% identity, 94% coverage: 2:185/195 of query aligns to 4:176/191 of 1tipA
1c81A Michaelis complex of fructose-2,6-bisphosphatase
31% identity, 94% coverage: 2:185/195 of query aligns to 4:176/191 of 1c81A
1c80A Regulatory complex of fructose-2,6-bisphosphatase
31% identity, 94% coverage: 2:185/195 of query aligns to 4:176/191 of 1c80A
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
31% identity, 94% coverage: 2:185/195 of query aligns to 4:176/191 of 1c7zA
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
31% identity, 94% coverage: 2:185/195 of query aligns to 3:175/190 of 1fbtA
P07953 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 94% coverage: 2:185/195 of query aligns to 254:426/471 of P07953
Sites not aligning to the query:
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
31% identity, 85% coverage: 2:166/195 of query aligns to 4:161/207 of 4ij6A
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
30% identity, 94% coverage: 2:185/195 of query aligns to 215:387/432 of 1k6mA
Sites not aligning to the query:
P16118 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see paper)
30% identity, 94% coverage: 2:185/195 of query aligns to 254:426/471 of P16118
Sites not aligning to the query:
6ic0A Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 4 (see paper)
29% identity, 94% coverage: 2:185/195 of query aligns to 231:403/428 of 6ic0A
Sites not aligning to the query:
6ibyA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 (see paper)
29% identity, 94% coverage: 2:185/195 of query aligns to 230:402/428 of 6ibyA
Sites not aligning to the query:
3qpuA Pfkfb3 in complex with ppi (see paper)
29% identity, 94% coverage: 2:185/195 of query aligns to 241:413/439 of 3qpuA
Sites not aligning to the query:
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
29% identity, 94% coverage: 2:185/195 of query aligns to 232:404/430 of 6hvjA
Sites not aligning to the query:
6ibxA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 5 (see paper)
29% identity, 94% coverage: 2:185/195 of query aligns to 231:403/429 of 6ibxA
Sites not aligning to the query:
>WP_012384411.1 NCBI__GCF_000019845.1:WP_012384411.1
MIYLVRHGQTEFNAQGRFQGQVDSPLTARGKDQARQIGGMLRRLIEPDHAIVFASPLGRT
KQTAHILAEAAGIRQEIVFDPGLMEIGMGCWEGLTNSEIEANWPDARSGFSRNEWYFHSP
DGERYEAFSDRLEGALHRVTSHSCTSRIIVSHGVASRVLRGLYANLPRDEALSLETPQDA
MFQLTEGQINRIACD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory