Comparing WP_012400006.1 NCBI__GCF_000020045.1:WP_012400006.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
45% identity, 97% coverage: 11:391/394 of query aligns to 11:390/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
45% identity, 97% coverage: 11:391/394 of query aligns to 3:382/385 of Q9X2A5
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
41% identity, 97% coverage: 11:391/394 of query aligns to 1:376/376 of O66442
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
42% identity, 96% coverage: 2:380/394 of query aligns to 7:384/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
42% identity, 96% coverage: 2:380/394 of query aligns to 7:384/401 of 4adbB
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
42% identity, 97% coverage: 11:391/394 of query aligns to 3:375/375 of 2eh6A
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
41% identity, 96% coverage: 17:394/394 of query aligns to 10:388/388 of 3nx3A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 96% coverage: 17:394/394 of query aligns to 75:456/457 of Q9M8M7
Sites not aligning to the query:
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
39% identity, 91% coverage: 25:384/394 of query aligns to 26:388/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 91% coverage: 25:384/394 of query aligns to 31:393/405 of P40732
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
38% identity, 91% coverage: 25:384/394 of query aligns to 20:377/389 of 2pb0A
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
38% identity, 91% coverage: 25:384/394 of query aligns to 26:383/397 of 4jewA
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 95% coverage: 18:393/394 of query aligns to 18:385/390 of A0QYS9
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
35% identity, 95% coverage: 18:390/394 of query aligns to 17:389/390 of 8ht4B
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
35% identity, 98% coverage: 5:391/394 of query aligns to 16:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 98% coverage: 5:391/394 of query aligns to 8:386/387 of 1wkhA
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 98% coverage: 5:391/394 of query aligns to 8:386/387 of 1wkgA
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 98% coverage: 5:391/394 of query aligns to 8:386/387 of 1vefA
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
36% identity, 95% coverage: 18:392/394 of query aligns to 20:388/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
36% identity, 95% coverage: 18:392/394 of query aligns to 20:388/391 of 7nn4A
Sites not aligning to the query:
>WP_012400006.1 NCBI__GCF_000020045.1:WP_012400006.1
MNFNEYPIDSLMYITNRPEIVFTHGKGSWLYDNTGKRYLDFIQGWAVNSLGHCNDGVIEA
LTQQARTLINPSPAFYNEPMAKLAGLLTQHSCFDKVFFTNSGAEANEGAIKLARKYGKKF
KNGAYEIITFDHSFHGRTLATMSASGKPGWDTIYAPQVPGFPKAELNDIASVEKLINDKT
IAVMLEPIQGEGGVIPATREFMQQLRELTTKHNLLLIVDEVQSGCGRAGTLFAYELSGIE
PDVMTLAKGIGSGVPLGALLCKKHVEVFEAGDQGGTYNGNPLMTAAGYSVISQLTAPGFL
EGVRARGEYLRTKLLELSAERGFEGERGEGLLRALLLGKDIGNQIVEKARLMQPDGLLLN
AARPNLLRFMPALNVSTEEIDQMMSMLRSILDTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory