Comparing WP_012401933.1 NCBI__GCF_000020045.1:WP_012401933.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
27% identity, 92% coverage: 3:207/223 of query aligns to 2:201/207 of 4ij6A
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
28% identity, 91% coverage: 3:206/223 of query aligns to 2:196/196 of 6m1xC
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
32% identity, 92% coverage: 2:206/223 of query aligns to 1:201/207 of 1h2fA
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
32% identity, 92% coverage: 2:206/223 of query aligns to 1:201/207 of 1h2eA
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
28% identity, 91% coverage: 3:206/223 of query aligns to 2:196/198 of 5zr2C
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 76% coverage: 5:173/223 of query aligns to 10:180/211 of P36623
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
34% identity, 55% coverage: 3:124/223 of query aligns to 2:123/239 of 1e59A
Sites not aligning to the query:
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
33% identity, 55% coverage: 2:124/223 of query aligns to 3:125/250 of P62707
Sites not aligning to the query:
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 70% coverage: 2:158/223 of query aligns to 3:161/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
32% identity, 70% coverage: 2:158/223 of query aligns to 1:159/209 of 4qihA
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
32% identity, 70% coverage: 2:158/223 of query aligns to 2:160/217 of 4pzaB
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
26% identity, 75% coverage: 4:171/223 of query aligns to 2:196/240 of 1qhfA
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
26% identity, 75% coverage: 4:171/223 of query aligns to 2:196/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
26% identity, 75% coverage: 4:171/223 of query aligns to 2:196/234 of 1bq4A
Sites not aligning to the query:
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
26% identity, 75% coverage: 4:171/223 of query aligns to 2:196/234 of 1bq3A
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
26% identity, 75% coverage: 4:171/223 of query aligns to 3:197/247 of P00950
Sites not aligning to the query:
7n3rB The ternary complex of human bisphosphoglycerate mutase with 3- phosphoglycerate and 2-phosphoglycolate (see paper)
28% identity, 59% coverage: 4:135/223 of query aligns to 3:134/239 of 7n3rB
2h4zA Human bisphosphoglycerate mutase complexed with 2,3- bisphosphoglycerate (see paper)
28% identity, 59% coverage: 4:135/223 of query aligns to 4:135/255 of 2h4zA
Sites not aligning to the query:
P07738 Bisphosphoglycerate mutase; BPGM; 2,3-bisphosphoglycerate mutase, erythrocyte; 2,3-bisphosphoglycerate synthase; 2,3-diphosphoglycerate mutase; DPGM; BPG-dependent PGAM; EC 5.4.2.4; EC 5.4.2.11 from Homo sapiens (Human) (see 5 papers)
28% identity, 59% coverage: 4:135/223 of query aligns to 5:136/259 of P07738
Sites not aligning to the query:
2f90A Crystal structure of bisphosphoglycerate mutase in complex with 3- phosphoglycerate and alf4- (see paper)
28% identity, 59% coverage: 4:135/223 of query aligns to 3:134/254 of 2f90A
Sites not aligning to the query:
>WP_012401933.1 NCBI__GCF_000020045.1:WP_012401933.1
MATQVLFIRHGETDWNRIKRIQGHIDIPLATSGVEQAKRLAERFACEAHEGARLDAVYSS
DLMRARQTAQPFADVLGLRLQLREGLRERNYGAFQGHDSDEISLRFPDEYARWQTRDPGF
SPPEGESQRVFYHRVLHALEPIVAAHPDGRIACVAHGGVLDCVYRFANGLSLDAPRNYQL
LNTSVNVVDFEGGRATVVSWADVVHLGGHAKDDSFKTTPRPER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory