Comparing WP_012406419.1 NCBI__GCF_000020045.1:WP_012406419.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
63% identity, 98% coverage: 8:422/422 of query aligns to 5:420/422 of 6rl5G
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
31% identity, 95% coverage: 15:415/422 of query aligns to 5:374/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
31% identity, 95% coverage: 15:415/422 of query aligns to 4:373/375 of 2eh6A
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 95% coverage: 16:418/422 of query aligns to 17:422/426 of P22256
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
30% identity, 95% coverage: 16:418/422 of query aligns to 16:421/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
30% identity, 95% coverage: 16:418/422 of query aligns to 16:421/425 of 1sf2A
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
30% identity, 95% coverage: 16:418/422 of query aligns to 16:421/425 of 1szkA
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
32% identity, 96% coverage: 15:420/422 of query aligns to 12:393/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
32% identity, 96% coverage: 15:420/422 of query aligns to 4:385/385 of Q9X2A5
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
33% identity, 95% coverage: 15:417/422 of query aligns to 11:389/390 of 8ht4B
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
28% identity, 95% coverage: 15:417/422 of query aligns to 5:385/388 of 3nx3A
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
31% identity, 93% coverage: 29:419/422 of query aligns to 29:421/421 of P50457
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 93% coverage: 24:414/422 of query aligns to 29:391/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
30% identity, 93% coverage: 24:414/422 of query aligns to 21:383/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
30% identity, 93% coverage: 24:414/422 of query aligns to 21:383/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
30% identity, 93% coverage: 24:414/422 of query aligns to 21:383/387 of 1vefA
Sites not aligning to the query:
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 98% coverage: 6:417/422 of query aligns to 59:453/457 of Q9M8M7
Sites not aligning to the query:
O58478 Alanine/serine racemase; ASR; Ala/Ser racemase; EC 5.1.1.-; EC 5.1.1.1 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
29% identity, 95% coverage: 20:421/422 of query aligns to 50:462/474 of O58478
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 94% coverage: 23:419/422 of query aligns to 19:385/390 of A0QYS9
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
28% identity, 94% coverage: 24:420/422 of query aligns to 38:445/454 of O50131
>WP_012406419.1 NCBI__GCF_000020045.1:WP_012406419.1
MEHMIEKLTELESNVRTYSRAFPVVFCKARGAEIYSVDGRRYIDFLAGAGALNYGHNHPA
LKESIIEYLRGDNLVHSLDLWTTAKYTYLDTFDRLILKTRRLDYKVHLTGPTGTNAVEAA
IRLARKIKKRSTIVSFTNGFHGITMGSLALTGNAKFRSAAGLPSMGNAFMPFDNYFGKGV
DTLRYFKKCLSDRSSGLDYPAAVIVEVVQGEGGINVASPGWLQELETVCRDQDILLIIDD
IQAGCGRTGRFFSFEHAGVVPDLVTNSKSLSGFGLPFSQVLIRPEHDQWETGQYNGTFRG
NNAAMITGAKALEYFWSDDAFADEVRRKGEIVREGFLGLTDLLRYRQVEAEERGLGLMRG
IDVQSGALATKITAEAFRQGLIIETSGHSGQVIKCLCPLVTTGDQIEEAMQILRRSIDNV
LG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory