Comparing WP_012467221.1 NCBI__GCF_000020465.1:WP_012467221.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
43% identity, 99% coverage: 3:320/320 of query aligns to 53:365/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
34% identity, 97% coverage: 8:318/320 of query aligns to 7:291/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
34% identity, 97% coverage: 8:318/320 of query aligns to 7:291/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
34% identity, 97% coverage: 8:318/320 of query aligns to 7:291/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
34% identity, 97% coverage: 8:318/320 of query aligns to 7:291/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
34% identity, 97% coverage: 8:318/320 of query aligns to 7:291/296 of 1fwkA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
31% identity, 99% coverage: 4:320/320 of query aligns to 2:308/310 of P00547
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
29% identity, 90% coverage: 10:296/320 of query aligns to 16:281/295 of 6cyzA
>WP_012467221.1 NCBI__GCF_000020465.1:WP_012467221.1
MKTVKGFASATVGNVACGFDVLGFAITEPGDEVTLTLLDERKKDCPVSISGITGDGGALP
LDPKKNTSSFVVLKFLEYIRTHKGVDFTGHISLELKKNLPLSSGMGSSAASAAAALVAAN
ELLGQPCTKMELVHFAIEGERVACGSAHADNAAPAILGNFVLIRSYTPLDLITIPPPKDL
FCTLVHPHTELRTSFARSVLPRAIPLKTAIQQWGNVGALITGLLTSDYELIGRSLVDVVA
EPKRAPLIPGFFDVKHAALDAGALGCSIAGSGPSLFAFSSSEKTAREAGNAMQQAFLSPK
TNLDSDMWVSRICSEGAKIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory