SitesBLAST
Comparing WP_012467222.1 NCBI__GCF_000020465.1:WP_012467222.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
43% identity, 94% coverage: 1:409/437 of query aligns to 1:401/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
37% identity, 100% coverage: 1:437/437 of query aligns to 2:463/464 of 4f4fA
- active site: K113 (= K107)
- binding pyridoxal-5'-phosphate: F112 (= F106), K113 (= K107), T255 (≠ S250), G256 (= G251), N257 (= N252), F258 (≠ Y253), D260 (≠ N255), S308 (≠ A303), M309 (= M304), H387 (= H358), T410 (= T384)
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 91% coverage: 3:398/437 of query aligns to 7:463/514 of Q42598
- S319 (≠ H294) modified: Phosphoserine
- S321 (≠ T296) modified: Phosphoserine
1kl7A Crystal structure of threonine synthase from yeast (see paper)
38% identity, 91% coverage: 2:398/437 of query aligns to 6:460/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
33% identity, 89% coverage: 1:390/437 of query aligns to 5:432/496 of 8g1yA
- binding pyridoxal-5'-phosphate: F113 (= F106), K114 (= K107), D147 (= D138), T268 (≠ S250), G269 (= G251), N270 (= N252), F271 (≠ Y253), N273 (= N255), S322 (≠ A303), H400 (= H358), T426 (= T384)
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
26% identity, 66% coverage: 103:392/437 of query aligns to 124:405/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F106), K128 (= K107), D159 (= D138), G259 (≠ S250), G260 (= G251), N261 (= N252), L262 (≠ Y253), G263 (= G254), N264 (= N255), A321 (= A303), H369 (= H358), T397 (= T384)
- binding s-adenosylmethionine: Q246 (= Q238), F247 (≠ Y239)
Sites not aligning to the query:
- binding s-adenosylmethionine: 64, 65, 66, 67, 69, 90, 92, 97, 98, 100, 115, 115
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 66% coverage: 103:392/437 of query aligns to 199:480/526 of Q9S7B5
- L205 (≠ Y109) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
Sites not aligning to the query:
- 172 binding
- 173 binding
- 181 binding in monomer B; binding in monomer A
- 187 binding in monomer B
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
25% identity, 66% coverage: 103:392/437 of query aligns to 142:407/448 of 2c2gA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
25% identity, 49% coverage: 102:314/437 of query aligns to 55:249/350 of 6nmxA
- active site: K60 (= K107), T84 (≠ S136), E216 (≠ N277), S220 (= S281), A238 (= A303)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K107), S83 (≠ T135), T84 (≠ S136), N86 (≠ D138), T87 (= T139), F133 (= F188), N153 (= N214), S154 (= S215), R159 (= R220), V185 (≠ S250), G186 (= G251), N187 (= N252), A188 (≠ Y253), G189 (= G254), N190 (= N255), A238 (= A303), I239 (≠ M304)
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
25% identity, 49% coverage: 102:314/437 of query aligns to 53:247/345 of 6cgqB
- active site: K58 (= K107), T82 (≠ S136), E214 (≠ N277), S218 (= S281), A236 (= A303)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K107), S81 (≠ T135), T82 (≠ S136), N84 (≠ D138), T85 (= T139), V183 (≠ S250), G184 (= G251), N185 (= N252), A186 (≠ Y253), N188 (= N255), A236 (= A303), I237 (≠ M304)
- binding phosphate ion: K58 (= K107), T85 (= T139), N151 (= N214), S152 (= S215), R157 (= R220), N185 (= N252)
Sites not aligning to the query:
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 61% coverage: 102:366/437 of query aligns to 64:306/360 of P9WG59
- K69 (= K107) modified: N6-(pyridoxal phosphate)lysine
- N95 (≠ D138) binding
- K151 (≠ Q197) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ GNYGN 251:255) binding
Sites not aligning to the query:
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
25% identity, 61% coverage: 102:366/437 of query aligns to 55:297/349 of 2d1fA
- active site: K60 (= K107), T84 (≠ S136), D209 (vs. gap), R213 (= R263), L215 (≠ M265), A240 (= A303)
- binding pyridoxal-5'-phosphate: F59 (= F106), K60 (= K107), N86 (≠ D138), V186 (≠ S250), G187 (= G251), N188 (= N252), A189 (≠ Y253), G190 (= G254), N191 (= N255), A240 (= A303)
Sites not aligning to the query:
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 61% coverage: 102:366/437 of query aligns to 64:306/360 of A0R220
- K151 (≠ Q197) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
25% identity, 75% coverage: 81:408/437 of query aligns to 33:341/351 of 3aexA
- active site: K61 (= K107), T85 (≠ S136), P212 (≠ D280), G216 (≠ R284), Q218 (vs. gap), A240 (= A303), T317 (= T384)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K107), S84 (≠ T135), T85 (≠ S136), N87 (≠ D138), T88 (= T139), V186 (≠ S250), G187 (= G251), N188 (= N252), A189 (≠ Y253), G190 (= G254), N191 (= N255), A240 (= A303), I241 (≠ M304), E287 (≠ D356), T317 (= T384)
- binding phosphate ion: K61 (= K107), T88 (= T139), N154 (= N214), S155 (= S215), R160 (= R220), N188 (= N252)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
25% identity, 75% coverage: 81:408/437 of query aligns to 33:341/351 of 1v7cA
- active site: K61 (= K107), T85 (≠ S136), P212 (≠ D280), G216 (≠ R284), Q218 (vs. gap), A240 (= A303), T317 (= T384)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K107), S84 (≠ T135), T85 (≠ S136), N87 (≠ D138), T88 (= T139), F134 (= F188), N154 (= N214), S155 (= S215), R160 (= R220), V186 (≠ S250), G187 (= G251), N188 (= N252), A189 (≠ Y253), G190 (= G254), N191 (= N255), A240 (= A303), I241 (≠ M304), E287 (≠ D356), T317 (= T384)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
25% identity, 75% coverage: 81:408/437 of query aligns to 33:341/350 of 1uimA
- active site: K61 (= K107), T85 (≠ S136), P212 (≠ D280), G216 (≠ R284), Q218 (vs. gap), A240 (= A303), T317 (= T384)
- binding pyridoxal-5'-phosphate: F60 (= F106), K61 (= K107), N87 (≠ D138), G187 (= G251), N188 (= N252), A189 (≠ Y253), G190 (= G254), N191 (= N255), A240 (= A303), E287 (≠ D356), T317 (= T384), G318 (≠ A385)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
25% identity, 75% coverage: 81:408/437 of query aligns to 32:340/350 of 3aeyA
- active site: K60 (= K107), T84 (≠ S136), P211 (≠ D280), G215 (≠ R284), Q217 (vs. gap), A239 (= A303), T316 (= T384)
- binding sulfate ion: K60 (= K107), K60 (= K107), G85 (= G137), N86 (≠ D138), T87 (= T139), T87 (= T139), S154 (= S215), R159 (= R220), N187 (= N252), R228 (= R290), V230 (≠ D292), E231 (≠ P293), R232 (≠ H294), A239 (= A303)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
24% identity, 49% coverage: 102:314/437 of query aligns to 51:239/339 of 6cgqA
- active site: K56 (= K107), T80 (≠ S136), E206 (≠ N277), S210 (= S281), A228 (= A303)
- binding pyridoxal-5'-phosphate: F55 (= F106), K56 (= K107), N82 (≠ D138), V175 (≠ S250), G176 (= G251), N177 (= N252), A178 (≠ Y253), G179 (= G254), N180 (= N255), A228 (= A303)
Sites not aligning to the query:
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
26% identity, 56% coverage: 67:312/437 of query aligns to 13:249/350 of 2zsjA
- active site: K61 (= K107), T85 (≠ S136), Q218 (≠ A274), A222 (= A278), A240 (= A303)
- binding pyridoxal-5'-phosphate: F60 (= F106), K61 (= K107), N87 (≠ D138), V186 (≠ S250), G187 (= G251), N188 (= N252), A189 (≠ Y253), G190 (= G254), N191 (= N255), A240 (= A303)
Sites not aligning to the query:
Query Sequence
>WP_012467222.1 NCBI__GCF_000020465.1:WP_012467222.1
MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPVFSAPEMQLLEDGSFNNIAFAIAR
KFICGEIPPDQLSDIIDSCYPFETPLVELEKGTFIEELFSGPTLAFKDYGARFLARLTGY
FASEERKLITVLVATSGDTGSAVAYGFQGIQNTRVVLLYPSGKVSRLQEQQLTTAGGNVQ
ALEVQGDFDDCQRLVKQAFTDPELKERLTLTSANSINISRLIPQSFYYAWATLHLKAQYG
LEQPVFSVPSGNYGNLTAGVLARMMGFPIGHFIAASNANDSVTRYLDEGRYDPHPTIPTL
STAMDVGNPSNFARLRHFYGNDHHAMGKDITGIAISDDATVATIRDIFRRYGYVIDPHTA
VGFRALEEYRQTSGSRSPGIVLSTAHPAKFLEVIEDALEKEIEIPERLSVVLEKKKQAAM
IGTDYRELADFLKHLER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory