Comparing WP_012469282.1 NCBI__GCF_000020385.1:WP_012469282.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
52% identity, 99% coverage: 1:202/205 of query aligns to 1:203/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
50% identity, 99% coverage: 1:202/205 of query aligns to 1:192/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
32% identity, 91% coverage: 5:191/205 of query aligns to 258:439/452 of 1piiA
Sites not aligning to the query:
>WP_012469282.1 NCBI__GCF_000020385.1:WP_012469282.1
MIKVKICGITSPEDALTAVEAGADALGFVFYKESPRHIFPEEAARIINLLPPFVQAVGLF
VNEAPEIVNQVSRNCRLGLVQLHGDETPDYCRKIEQRVMKAFRVRSLTCLDPIADYRMSG
CLLDAYSPSFYGGTGKSFNWEIAREAMTRGHRIVLAGGLTPDNVAEAIRQVRPYAVDVSS
GVESAPGRKDADKVREFIRNAKEAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory