Comparing WP_012470078.1 NCBI__GCF_000020385.1:WP_012470078.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39215 Methyl-accepting chemotaxis protein McpB; H3 from Bacillus subtilis (strain 168) (see 2 papers)
25% identity, 56% coverage: 29:391/648 of query aligns to 34:361/662 of P39215
Sites not aligning to the query:
Q9HW93 Methyl-accepting chemotaxis protein PctC from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
23% identity, 59% coverage: 7:391/648 of query aligns to 11:360/632 of Q9HW93
6d8vA Methyl-accepting chemotaxis protein x (see paper)
26% identity, 32% coverage: 46:251/648 of query aligns to 15:224/269 of 6d8vA
G3XD24 Methyl-accepting chemotaxis protein PctA from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 3 papers)
25% identity, 38% coverage: 148:391/648 of query aligns to 128:357/629 of G3XD24
Sites not aligning to the query:
Q9HW91 Methyl-accepting chemotaxis protein PctB from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
25% identity, 38% coverage: 148:391/648 of query aligns to 128:357/629 of Q9HW91
Sites not aligning to the query:
3f79E Structure of pseudo-centered cell crystal form of thE C-terminal phosphatase domain of p. Aeruginosa rssb
27% identity, 26% coverage: 434:599/648 of query aligns to 39:205/236 of 3f79E
6k4eB Siaa-pp2c domain of pseudomonas aeruginosa (see paper)
26% identity, 38% coverage: 392:639/648 of query aligns to 2:245/246 of 6k4eB
5avfA The ligand binding domain of mlp37 with taurine (see paper)
25% identity, 27% coverage: 63:235/648 of query aligns to 17:186/244 of 5avfA
3c8cA Crystal structure of mcp_n and cache domains of methyl-accepting chemotaxis protein from vibrio cholerae
25% identity, 27% coverage: 63:235/648 of query aligns to 9:178/240 of 3c8cA
Sites not aligning to the query:
6iovA The ligand binding domain of mlp37 with arginine (see paper)
25% identity, 27% coverage: 63:235/648 of query aligns to 5:174/224 of 6iovA
5aveA The ligand binding domain of mlp37 with serine (see paper)
25% identity, 27% coverage: 63:235/648 of query aligns to 13:182/252 of 5aveA
7prqB Structure of the ligand binding domain of the pctd (pa4633) chemoreceptor of pseudomonas aeruginosa pao1 in complex with choline. (see paper)
23% identity, 43% coverage: 33:310/648 of query aligns to 6:310/316 of 7prqB
P39214 Methyl-accepting chemotaxis protein McpA; H1 from Bacillus subtilis (strain 168) (see 2 papers)
23% identity, 38% coverage: 147:391/648 of query aligns to 138:360/661 of P39214
Sites not aligning to the query:
7prrA Structure of the ligand binding domain of the pctd (pa4633) chemoreceptor of pseudomonas aeruginosa pao1 in complex with acetylcholine (see paper)
23% identity, 42% coverage: 37:310/648 of query aligns to 2:302/304 of 7prrA
O34206 Alginate biosynthesis sensor protein KinB; EC 2.7.13.3 from Pseudomonas aeruginosa (see paper)
33% identity, 14% coverage: 308:397/648 of query aligns to 167:258/595 of O34206
Sites not aligning to the query:
5t7mA Ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-trp
26% identity, 21% coverage: 148:283/648 of query aligns to 99:228/241 of 5t7mA
Sites not aligning to the query:
5t65A Ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-ile
26% identity, 21% coverage: 148:283/648 of query aligns to 99:228/240 of 5t65A
Sites not aligning to the query:
5ltxA Ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-met
26% identity, 21% coverage: 148:283/648 of query aligns to 99:228/243 of 5ltxA
Sites not aligning to the query:
8if3A Structure of human alpha-2/delta-1 with mirogabalin (see paper)
30% identity, 16% coverage: 193:298/648 of query aligns to 442:557/917 of 8if3A
Sites not aligning to the query:
5ltoA Ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptors pctb in complex with l-gln
31% identity, 14% coverage: 148:238/648 of query aligns to 93:178/237 of 5ltoA
Sites not aligning to the query:
>WP_012470078.1 NCBI__GCF_000020385.1:WP_012470078.1
MPGKSSIVVRLVFVITLCCSCIFAAALGYNYYRSRQILEQELENNARNLAMSLVHRVETE
LVAVAKVTEGVARSLETGRYSEQELLALIRATVEKNPEIYGSTVAFEPYAFSKSTRLYAP
YFYREKGSIAFSRLETAYQHVPYLYWDWYQIPRELGKREWSEPYFDEGAGNISMSTCSVP
FYDTVNGIKHLKGVVTADISLDSLTKLVSSTRILKTGYAALLSRNGMLLAHPLKDAVMNE
TFFSIAEERKDPSLRELGKKMVRGESGFILYKSLVGVRSWMYYTPIRSTGWTLAVVFPES
ELLENVRRLSMTMAAMGFVGILVLTAAVVSIASSITKPLRSLAAATHLMASGNFDLDLPP
IRTKDEVGLLTQDFQMMKESLKEYIRNLTETTAAKERIKSELKVATDIQASLLPRLFPAF
PDRPEFDIFASMDPAKEVGGDFYDFFFIDAHNLCFLIADVAGKGVPAALYMMVAKTLLKS
EGQRLGEPDQILGYVNNVLATDNDSCMFATVFCGILDVRTGEVRFANAGHNPPLLIESQK
IRYLNLKPGFVLGPMQDMTYTTEHLTLQPGDTLFMYTDGVTEATNRADELYGEEQLLQAL
QRVPDLELTDMVHYIRDEITHHANGAPQSDDVTMVAIKYRGIQDDRKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory