SitesBLAST
Comparing WP_012470140.1 NCBI__GCF_000020385.1:WP_012470140.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3r7lA Crystal structure of pala-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
39% identity, 95% coverage: 6:300/310 of query aligns to 2:285/290 of 3r7lA
- active site: R49 (= R58), T50 (= T59), K77 (= K86), R99 (= R108), H127 (= H136), Q130 (= Q139), L210 (= L223), P249 (= P264), G277 (= G292)
- binding n-(phosphonacetyl)-l-aspartic acid: S47 (= S56), T48 (= T57), R49 (= R58), T50 (= T59), S74 (= S83), K77 (= K86), R99 (= R108), H127 (= H136), R160 (= R169), R211 (= R224), Q213 (= Q226), A250 (≠ G265)
P05654 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Bacillus subtilis (strain 168) (see paper)
39% identity, 95% coverage: 6:300/310 of query aligns to 2:285/304 of P05654
Sites not aligning to the query:
- 303 modified: Phosphoserine
3r7fA Crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
39% identity, 95% coverage: 6:300/310 of query aligns to 2:285/291 of 3r7fA
- active site: R49 (= R58), T50 (= T59), K77 (= K86), R99 (= R108), H127 (= H136), Q130 (= Q139), L210 (= L223), P249 (= P264), G277 (= G292)
- binding phosphoric acid mono(formamide)ester: S47 (= S56), T48 (= T57), R49 (= R58), T50 (= T59), R99 (= R108), H127 (= H136), Q130 (= Q139), P249 (= P264), A250 (≠ G265)
- binding phosphate ion: S11 (= S15), T12 (≠ K16), Q23 (≠ E27), K26 (≠ R30), E140 (≠ D149), R171 (≠ K180), K241 (= K256), H243 (≠ D258), K272 (= K287), K272 (= K287), K275 (≠ E290)
3r7dA Crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis (see paper)
39% identity, 95% coverage: 6:300/310 of query aligns to 2:285/291 of 3r7dA
- active site: R49 (= R58), T50 (= T59), K77 (= K86), R99 (= R108), H127 (= H136), Q130 (= Q139), L210 (= L223), P249 (= P264), G277 (= G292)
- binding phosphate ion: S11 (= S15), T12 (≠ K16), T73 (≠ S82), S74 (= S83), K77 (= K86), R171 (≠ K180)
6pnzA The structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
37% identity, 95% coverage: 8:300/310 of query aligns to 4:288/293 of 6pnzA
- binding n-(phosphonacetyl)-l-aspartic acid: S48 (= S56), T49 (= T57), R50 (= R58), T51 (= T59), S75 (= S83), K78 (= K86), R100 (= R108), H127 (= H136), R160 (= R169), R210 (= R224), Q212 (= Q226), A253 (≠ G265)
4bjhB Crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) (see paper)
39% identity, 95% coverage: 6:299/310 of query aligns to 2:285/291 of 4bjhB
- active site: R47 (= R58), T48 (= T59), K75 (= K86), R97 (= R108), H126 (= H136), Q129 (= Q139)
- binding n-(phosphonacetyl)-l-aspartic acid: S45 (= S56), T46 (= T57), R47 (= R58), T48 (= T59), R97 (= R108), H126 (= H136), R159 (= R169), V160 (= V170), R213 (= R224), Q215 (= Q226), G251 (= G265)
3d6nB Crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase (see paper)
39% identity, 95% coverage: 6:299/310 of query aligns to 2:285/291 of 3d6nB
- active site: R47 (= R58), T48 (= T59), K75 (= K86), R97 (= R108), H126 (= H136), Q129 (= Q139)
- binding citrate anion: T48 (= T59), R97 (= R108), H126 (= H136), R159 (= R169), V160 (= V170), R213 (= R224), G251 (= G265)
1ml4A The pala-liganded aspartate transcarbamoylase catalytic subunit from pyrococcus abyssi (see paper)
37% identity, 98% coverage: 2:305/310 of query aligns to 1:305/307 of 1ml4A
- active site: R56 (= R58), T57 (= T59), K85 (= K86), R106 (= R108), H134 (= H136), Q137 (= Q139), T227 (≠ L223), P266 (= P264), G292 (= G292)
- binding n-(phosphonacetyl)-l-aspartic acid: S54 (= S56), T55 (= T57), R56 (= R58), T57 (= T59), R106 (= R108), H134 (= H136), R167 (= R169), T168 (≠ V170), R228 (= R224), L267 (≠ G265)
5g1nE Aspartate transcarbamoylase domain of human cad bound to pala (see paper)
35% identity, 97% coverage: 6:305/310 of query aligns to 6:305/307 of 5g1nE
- active site: R57 (= R58), T58 (= T59), K85 (= K86), R106 (= R108), H134 (= H136), Q137 (= Q139), T227 (≠ L223), P266 (= P264), G292 (= G292)
- binding n-(phosphonacetyl)-l-aspartic acid: S55 (= S56), T56 (= T57), R57 (= R58), T58 (= T59), S82 (= S83), K85 (= K86), R106 (= R108), H134 (= H136), R167 (= R169), R228 (= R224), Q230 (= Q226), M267 (≠ G265)
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
35% identity, 97% coverage: 6:305/310 of query aligns to 1924:2223/2225 of P08955
Sites not aligning to the query:
- 1406 modified: Phosphoserine; by PKA; S→A: No effect on enzyme kinetics.; S→D: Increases CPSase activity and reduces sensitivity to feedback inhibition by UTP.
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
35% identity, 97% coverage: 6:305/310 of query aligns to 1924:2223/2225 of P27708
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 33 M → R: in DEE50; uncertain significance; dbSNP:rs751610198
- 177 R → Q: in a colorectal cancer sample; somatic mutation; dbSNP:rs374122292
- 456 modified: Phosphothreonine; by MAPK1
- 735 Y → C: in a colorectal cancer sample; somatic mutation
- 1406 modified: Phosphoserine; by PKA
- 1471 binding Zn(2+); binding Zn(2+); H→A: No zinc-binding and no catalytic activity.; H→N: Abolishes dihydroorotase activity.
- 1473 binding Zn(2+); H→A: No zinc-binding and no catalytic activity.
- 1475 binding (S)-dihydroorotate
- 1505 binding (S)-dihydroorotate
- 1512 D→N: No change in catalytic activity.
- 1556 binding via carbamate group; binding via carbamate group; modified: N6-carboxylysine
- 1562 T→A: Abolishes dihydroorotase activity.
- 1563 F→A: Abolishes dihydroorotase activity.
- 1590 binding Zn(2+); H→A: Abolishes dihydroorotase activity.; H→N: No catalytic activity.
- 1613 binding Zn(2+); C→S: Reduces dihydroorotase activity.
- 1614 binding Zn(2+); H→A: Abolishes dihydroorotase activity.
- 1637 binding Zn(2+); E→T: Abolishes dihydroorotase activity.
- 1642 H→N: 11.5% of wild-type catalytic activity.
- 1661 binding (S)-dihydroorotate
- 1686 binding Zn(2+); D→N: Abolishes dihydroorotase activity.
- 1690 binding (S)-dihydroorotate; H→N: 3% of wild-type catalytic activity.
- 1702 binding (S)-dihydroorotate
- 1789:2225 natural variant: Missing (in DEE50; uncertain significance)
- 1859 modified: Phosphoserine; by RPS6KB1 and PKA
- 1873 modified: Phosphoserine; by PKC; in vitro; S→A: Abolishes PMA-induced Thr-456 phosphorylation.
- 1900 modified: Phosphoserine
5g1pA Aspartate transcarbamoylase domain of human cad bound to carbamoyl phosphate (see paper)
34% identity, 97% coverage: 6:305/310 of query aligns to 3:290/292 of 5g1pA
- active site: R54 (= R58), T55 (= T59), K82 (= K86), R103 (= R108), H131 (= H136), Q134 (= Q139), T223 (≠ L223), P251 (= P264), G277 (= G292)
- binding phosphoric acid mono(formamide)ester: S52 (= S56), T53 (= T57), R54 (= R58), T55 (= T59), R103 (= R108), Q134 (= Q139), M252 (≠ G265)
2hseA Structure of d236a e. Coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2hseA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding aspartic acid: R54 (= R58), T55 (= T59), S58 (= S62), R105 (= R108), H134 (= H136), Q137 (= Q139), R167 (= R169), R229 (= R224), Q231 (= Q226), L267 (≠ G265), P268 (= P266), A289 (≠ V289), R296 (= R296)
- binding phosphonoacetamide: S52 (= S56), T53 (= T57), R54 (= R58), T55 (= T59), R105 (= R108), L267 (≠ G265)
2a0fA Structure of d236a mutant e. Coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution (see paper)
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2a0fA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding phosphonoacetamide: R54 (= R58), T55 (= T59), H134 (= H136), Q137 (= Q139), L267 (≠ G265)
8bplA Aspartate transcarbamoylase mutant (n2045c, r2238c) from chaetomium thermophilum cad-like bound to carbamoyl phosphate (see paper)
33% identity, 96% coverage: 3:300/310 of query aligns to 13:311/316 of 8bplA
P0A786 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 95% coverage: 5:300/310 of query aligns to 7:301/311 of P0A786
- R55 (= R58) binding carbamoyl phosphate
- T56 (= T59) binding carbamoyl phosphate
- R106 (= R108) binding carbamoyl phosphate
- H135 (= H136) binding carbamoyl phosphate
- Q138 (= Q139) binding carbamoyl phosphate
- L268 (≠ G265) binding carbamoyl phosphate
- P269 (= P266) binding carbamoyl phosphate
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ipoA E. Coli aspartate transcarbamoylase complexed with n-phosphonacetyl-l- asparagine (see paper)
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2ipoA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding n~2~-(phosphonoacetyl)-l-asparagine: S52 (= S56), T53 (= T57), R54 (= R58), T55 (= T59), R105 (= R108), H134 (= H136), R167 (= R169), T168 (≠ V170), R229 (= R224), L267 (≠ G265)
2h3eA Structure of wild-type e. Coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution (see paper)
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2h3eA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding (s)-4-amino-4-oxo-3-(2-phosphonoacetamido)butanoic acid: S52 (= S56), T53 (= T57), R54 (= R58), T55 (= T59), R105 (= R108), H134 (= H136), R167 (= R169), R229 (= R224), L267 (≠ G265)
2fzkA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.50 resolution (see paper)
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2fzkA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding 3,5-bis[(phosphonoacetyl)amino]benzoic acid: T55 (= T59), H134 (= H136), Q137 (= Q139), T168 (≠ V170), R229 (= R224), P266 (= P264), L267 (≠ G265), R296 (= R296)
2fzgA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.25 resolution (see paper)
33% identity, 95% coverage: 5:300/310 of query aligns to 6:300/310 of 2fzgA
- active site: R54 (= R58), T55 (= T59), K84 (= K86), R105 (= R108), H134 (= H136), Q137 (= Q139), T228 (≠ L223), P266 (= P264), G292 (= G292)
- binding {1,3-phenylenebis[imino(2-oxoethane-2,1-diyl)]}bis(phosphonic acid): S52 (= S56), R54 (= R58), T55 (= T59), R105 (= R108), H134 (= H136), R167 (= R169), T168 (≠ V170), R229 (= R224), P266 (= P264), L267 (≠ G265)
Query Sequence
>WP_012470140.1 NCBI__GCF_000020385.1:WP_012470140.1
MEFKHKDIIALRDLSKEEIELLISTAENMREVNSRDIKKVPTLRGKTIINLFYESSTRTR
TSFEIAGKRLSADTVNIAPSNSSATKGETLADTALNLLAMKPDIIVMRHAVSGSHYFLSK
KVGCSIINAGDGAHEHPSQGLLDMLTIKDKFGRLDGLKVAMVGDITHSRVARSNIQGLTK
MGSSIFLAGPPTMMPPGVEQLGNVTVCGTMKEAIQDADVVIMLRIQQERQGKTLMPNTRE
YSRYFGLNPENVKWAKPDAMVMHPGPINRGVEMSSYVVDGNQSHILKQVENGVAVRMAML
YHVCGGGNVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory