Comparing WP_012501773.1 NCBI__GCF_000020505.1:WP_012501773.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
47% identity, 79% coverage: 50:251/256 of query aligns to 47:248/258 of 3t55A
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
47% identity, 79% coverage: 50:251/256 of query aligns to 47:248/259 of 3t44A
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
47% identity, 79% coverage: 50:251/256 of query aligns to 47:246/257 of 3t78A
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
41% identity, 95% coverage: 2:245/256 of query aligns to 4:250/265 of 6y88B
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
41% identity, 96% coverage: 4:250/256 of query aligns to 12:245/254 of 1vc4B
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
44% identity, 75% coverage: 53:245/256 of query aligns to 48:237/253 of 6y88G
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
44% identity, 79% coverage: 50:251/256 of query aligns to 47:234/251 of 3t40A
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
36% identity, 98% coverage: 2:251/256 of query aligns to 3:246/452 of 1piiA
Sites not aligning to the query:
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
35% identity, 97% coverage: 4:251/256 of query aligns to 5:246/259 of 1jcmP
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
38% identity, 79% coverage: 53:253/256 of query aligns to 47:245/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
38% identity, 79% coverage: 53:253/256 of query aligns to 47:245/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
38% identity, 79% coverage: 53:253/256 of query aligns to 47:245/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
38% identity, 79% coverage: 53:253/256 of query aligns to 47:245/247 of 1a53A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
36% identity, 77% coverage: 53:249/256 of query aligns to 47:240/247 of 4iwwA
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
34% identity, 100% coverage: 2:256/256 of query aligns to 5:258/472 of 7etxA
Sites not aligning to the query:
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
34% identity, 100% coverage: 2:256/256 of query aligns to 3:256/470 of 7etyA
Sites not aligning to the query:
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
34% identity, 77% coverage: 53:249/256 of query aligns to 47:240/247 of 4ou1A
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
34% identity, 79% coverage: 53:253/256 of query aligns to 47:238/240 of 5k7jA
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
35% identity, 77% coverage: 53:249/256 of query aligns to 47:240/247 of 3uxdA
3nz1A Crystal structure of kemp elimination catalyst 1a53-2 complexed with transition state analog 5-nitro benzotriazole (see paper)
32% identity, 80% coverage: 53:256/256 of query aligns to 47:248/249 of 3nz1A
>WP_012501773.1 NCBI__GCF_000020505.1:WP_012501773.1
MTYLTRILETKAEEVAELKKQDPERRYHEACGDLPATRDFRSAITSLDGGINLIAEVKKA
SPSRGVLVEDFRPLDIAERYAEIGASAFSVLTDRQYFQGSPDYLKAITQKFSIPVLRKEF
IIDESQIYETRLMGADAALLIVAALEPSQLRDYLQLFAELGLHALVETHDERELDTALEQ
GSTIVGVNNRDLKTFTVDLMTSVRLRQRMPDGIVSVAESGMKHRDDIQMMQEAGFDAVLI
GEGLLVSEELRQFSWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory