Comparing WP_012506211.1 NCBI__GCF_000020625.1:WP_012506211.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
41% identity, 97% coverage: 12:403/404 of query aligns to 3:392/393 of 1xi9C
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
36% identity, 97% coverage: 12:403/404 of query aligns to 7:401/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
36% identity, 97% coverage: 12:403/404 of query aligns to 7:401/405 of P0A959
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
32% identity, 92% coverage: 22:391/404 of query aligns to 56:429/454 of P17735
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
31% identity, 92% coverage: 22:391/404 of query aligns to 56:429/454 of P04694
Sites not aligning to the query:
3dydA Human tyrosine aminotransferase
33% identity, 88% coverage: 37:391/404 of query aligns to 15:373/388 of 3dydA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
33% identity, 92% coverage: 12:383/404 of query aligns to 5:364/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
33% identity, 92% coverage: 12:383/404 of query aligns to 5:364/382 of 1gc3A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
33% identity, 92% coverage: 12:383/404 of query aligns to 5:364/382 of 1b5oA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
32% identity, 92% coverage: 12:383/404 of query aligns to 5:364/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
32% identity, 92% coverage: 12:383/404 of query aligns to 5:364/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
32% identity, 92% coverage: 12:383/404 of query aligns to 5:364/385 of Q56232
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
31% identity, 90% coverage: 37:400/404 of query aligns to 74:437/464 of Q93703
1j32A Aspartate aminotransferase from phormidium lapideum
27% identity, 97% coverage: 12:404/404 of query aligns to 4:387/388 of 1j32A
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
30% identity, 97% coverage: 12:402/404 of query aligns to 3:369/370 of Q58097
3ihjA Human alanine aminotransferase 2 in complex with plp
30% identity, 80% coverage: 81:404/404 of query aligns to 93:458/461 of 3ihjA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 93% coverage: 28:403/404 of query aligns to 28:384/384 of 1o4sB
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 98% coverage: 9:404/404 of query aligns to 12:409/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
26% identity, 98% coverage: 9:404/404 of query aligns to 2:399/400 of 6f35A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 93% coverage: 25:400/404 of query aligns to 19:395/400 of Q02635
Sites not aligning to the query:
>WP_012506211.1 NCBI__GCF_000020625.1:WP_012506211.1
MPYTHSPVFTPAQRVQNYNYAIRNIVTHARKLEAQGKKITYLNIGDPVLYGFQPPEELIE
ANVLALRHGHNGYSPSSGRKEAVEAIAEDACRRGISTSPDNVIITFGASEAADLVCTSML
NPGDEVLCPSPGYPLYNAIIAKLNAREVRYSLDPANDWLPDPEQVEKSITPRTKILVVIN
PNNPTGELYSRETLDMFVDIARRHKLLIITDEVYHKLVYEGEHIPLASLASDDVAVITID
SLSKNYMAPGWRTGWLMITNSALIPDVRQAFIKLADARLCAPMAPQYTIKAAMTMGPEYN
ETILSRLRAQRELTIDRLNAIEGFSCNKPSGAFYVMGKLDLDATPFKTDEEFVLKLLQEK
QVLFVHGSGFGTDPASGYARIVYLPDVTILEKVYADVADFINSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory