Comparing WP_012537591.1 NCBI__GCF_000021485.1:WP_012537591.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6sunA Amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami (see paper)
24% identity, 63% coverage: 32:225/310 of query aligns to 33:236/334 of 6sunA
Sites not aligning to the query:
6sumA Amicoumacin kinase hamin in complex with amp-pnp, mg2+ and ami (see paper)
24% identity, 63% coverage: 32:225/310 of query aligns to 33:236/335 of 6sumA
Sites not aligning to the query:
>WP_012537591.1 NCBI__GCF_000021485.1:WP_012537591.1
MSVYTNVSEHELAQFLRDYELGGACALTGISAGVENSNYFLDTEKGHFVLTIFERLPRNK
IPYFLDLTEWLSLHGIPCPRPVHTTAGTSLSTLCGKPAAIVQRLSGASIEGRVPSVTEIG
MLGTLLARMHLAGETFPERHPNPAGLLWWQETARHLVPHLSPENNAVIADEIAYQSALNR
RDLPGGVVHADLFPDNVLFEKGQISGTIDFYYAGDDAWLYDLAVVANAWCSEADGRFDRA
LVTALWDAYVATRPLQTGEEALWFPLLRAAALRFWLLRLDAMHFRRPGTITQCKDPEEYR
RILLMRQRGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory