SitesBLAST
Comparing WP_012566352.1 NCBI__GCF_000016185.1:WP_012566352.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
46% identity, 96% coverage: 12:396/401 of query aligns to 3:394/395 of P06721
- K210 (= K215) modified: N6-(pyridoxal phosphate)lysine
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
47% identity, 95% coverage: 15:396/401 of query aligns to 3:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
47% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 2gqnA
- active site: R54 (= R65), Y107 (= Y118), D181 (= D190), K206 (= K215)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), E108 (≠ G119), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
47% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 2fq6A
- active site: R54 (= R65), Y107 (= Y118), D181 (= D190), K206 (= K215)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), P109 (= P120), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
47% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 1cl2A
- active site: R54 (= R65), Y107 (= Y118), D181 (= D190), K206 (= K215)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
48% identity, 96% coverage: 12:396/401 of query aligns to 6:397/398 of 8sadA
- binding magnesium ion: A359 (vs. gap), R362 (= R361), A365 (≠ V364)
- binding pyridoxal-5'-phosphate: C88 (≠ S92), G89 (= G93), A90 (≠ L94), Y114 (= Y118), D188 (= D190), A210 (= A212), T212 (= T214), K213 (= K215), M222 (≠ T224), W343 (= W345)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
46% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 4itxA
- active site: R54 (= R65), Y107 (= Y118), D181 (= D190), K206 (= K215)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
48% identity, 95% coverage: 15:396/401 of query aligns to 3:391/392 of 8sabA
- binding lysine: N9 (≠ H21), R12 (= R24), R13 (≠ A25), K14 (≠ P26), T17 (≠ H29), L330 (= L338), E341 (= E349)
- binding pyridoxal-5'-phosphate: C82 (≠ S92), G83 (= G93), A84 (≠ L94), Y108 (= Y118), D182 (= D190), A204 (= A212), T206 (= T214), K207 (= K215), M216 (≠ T224), W337 (= W345)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S92), G83 (= G93), A84 (≠ L94), Y108 (= Y118), D182 (= D190), A204 (= A212), T206 (= T214), K207 (= K215), M216 (≠ T224), Y335 (= Y343), S336 (= S344), W337 (= W345), R369 (= R374)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
48% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), T205 (= T214), K206 (= K215), M215 (≠ T224), W336 (= W345)
- binding serine: Y107 (= Y118), K206 (= K215), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
48% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 8u98A
- binding glycine: Y107 (= Y118), K206 (= K215), Y334 (= Y343), S335 (= S344), W336 (= W345), R368 (= R374)
- binding pyridoxal-5'-phosphate: Y52 (= Y63), R54 (= R65), C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), W336 (= W345)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
48% identity, 95% coverage: 15:396/401 of query aligns to 2:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), W336 (= W345)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S92), G82 (= G93), A83 (≠ L94), Y107 (= Y118), D181 (= D190), A203 (= A212), T205 (= T214), K206 (= K215), M215 (≠ T224), S335 (= S344), W336 (= W345), R368 (= R374)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
33% identity, 95% coverage: 15:396/401 of query aligns to 3:373/373 of 4l0oH
- active site: R40 (= R65), Y92 (= Y118), D164 (= D190), K189 (= K215)
- binding pyridoxal-5'-phosphate: Y38 (= Y63), R40 (= R65), S67 (= S92), G68 (= G93), L69 (= L94), Y92 (= Y118), D164 (= D190), S186 (≠ A212), T188 (= T214), K189 (= K215)
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
33% identity, 94% coverage: 16:393/401 of query aligns to 4:376/377 of 7d7oB
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
35% identity, 95% coverage: 13:393/401 of query aligns to 2:380/384 of 4iyoD
- active site: R47 (= R65), Y99 (= Y118), D172 (= D190), K197 (= K215)
- binding serine: Y45 (= Y63), T48 (≠ M66), Y99 (= Y118), Y99 (= Y118), R104 (≠ H123), K197 (= K215), N227 (≠ S242), E325 (≠ Y343), S326 (= S344), T341 (≠ D358), R361 (= R374)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
35% identity, 95% coverage: 13:393/401 of query aligns to 2:380/381 of 4iyoB
- active site: R47 (= R65), Y99 (= Y118), D172 (= D190), K197 (= K215)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y63), R47 (= R65)
- binding amino-acrylate: Y99 (= Y118), K197 (= K215), S326 (= S344), T341 (≠ D358), R361 (= R374)
- binding pyruvic acid: Q221 (≠ R236), F224 (≠ V239)
- binding serine: Y45 (= Y63), T48 (≠ M66), Y99 (= Y118), R104 (≠ H123), N227 (≠ S242), E325 (≠ Y343)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
35% identity, 95% coverage: 13:393/401 of query aligns to 2:380/381 of 4iy7B
- active site: R47 (= R65), Y99 (= Y118), D172 (= D190), K197 (= K215)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y63), R47 (= R65)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G93), M76 (≠ L94), Y99 (= Y118), E143 (= E161), N147 (≠ S165), D172 (= D190), S194 (≠ A212), K197 (= K215), S326 (= S344), L327 (≠ W345), T341 (≠ D358), R361 (= R374)
- binding pyruvic acid: Q221 (≠ R236), F224 (≠ V239)
- binding serine: Y45 (= Y63), T48 (≠ M66), Y99 (= Y118), R104 (≠ H123), N227 (≠ S242), E325 (≠ Y343)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
35% identity, 95% coverage: 13:393/401 of query aligns to 2:380/381 of 4iy7A
- active site: R47 (= R65), Y99 (= Y118), D172 (= D190), K197 (= K215)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G93), M76 (≠ L94), Y99 (= Y118), E143 (= E161), N147 (≠ S165), D172 (= D190), S194 (≠ A212), K197 (= K215), S326 (= S344), L327 (≠ W345), T341 (≠ D358), R361 (= R374)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y63), R47 (= R65)
- binding serine: Y45 (= Y63), T48 (≠ M66), Y99 (= Y118), R104 (≠ H123), N227 (≠ S242), E325 (≠ Y343)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
35% identity, 95% coverage: 13:393/401 of query aligns to 2:380/381 of 4ixzA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
30% identity, 96% coverage: 11:395/401 of query aligns to 3:393/395 of 5m3zA
- active site: R58 (= R65), Y111 (= Y118), D183 (= D190), K208 (= K215)
- binding norleucine: Y111 (= Y118), H113 (≠ P120), K208 (= K215), V336 (≠ Y343), S337 (= S344)
- binding pyridoxal-5'-phosphate: G86 (= G93), I87 (≠ L94), Y111 (= Y118), E154 (= E161), D183 (= D190), T185 (= T192), S205 (≠ A212), T207 (= T214), K208 (= K215)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G93), I87 (≠ L94), Y111 (= Y118), D183 (= D190), S205 (≠ A212), T207 (= T214), K208 (= K215), V336 (≠ Y343), S337 (= S344), R372 (= R374)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
30% identity, 96% coverage: 11:395/401 of query aligns to 4:394/396 of 4omaA
- active site: R59 (= R65), Y112 (= Y118), D184 (= D190), K209 (= K215)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G93), I88 (≠ L94), Y112 (= Y118), D184 (= D190), S206 (≠ A212), T208 (= T214), K209 (= K215), V337 (≠ Y343), S338 (= S344), R373 (= R374)
Query Sequence
>WP_012566352.1 NCBI__GCF_000016185.1:WP_012566352.1
MNADTDSTPSRDLDLSTRLAHAGRAPGSHAGAVNIPPYRASTILHPTLAAFLAPDPEYRS
VRYGRMGTPSSHAFEEAMAELEGGCGAVAVGSGLQAITVALSAFVRAGDHILVTDSVYGP
TRHFCDQMLARLGVETEFYDPGIGAGIAGLIRENTRLIMLESPGSLTFEMQDVPAIVAAA
RARGCLTLIDNTWAAGVFFKPLALGVDVSIQAATKYVCGHSDATLGVIVAREEACRMAVK
QSAVMLGAAAGADDLFLALRGLRTLPVRLARHQETGIRLARWMAGQPEVRRVLHPALPDD
PGHALWQRDFTGACGLFAVELDRIPQDALAAMLDGLSLFGMGYSWGGFESLILPAFPDRI
RTAVPWRGRGTLIRLHAGLEDAEDLIRDLDRAFDRLRRTRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory