Comparing WP_012567937.1 NCBI__GCF_000016185.1:WP_012567937.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
44% identity, 96% coverage: 15:406/408 of query aligns to 2:391/393 of 3jtxB
2o1bA Structure of aminotransferase from staphylococcus aureus
26% identity, 89% coverage: 45:406/408 of query aligns to 22:371/376 of 2o1bA
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
27% identity, 89% coverage: 45:407/408 of query aligns to 20:375/380 of 2x5dD
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
29% identity, 89% coverage: 45:406/408 of query aligns to 35:387/392 of 6l1oB
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
29% identity, 89% coverage: 45:406/408 of query aligns to 35:387/393 of 6l1lB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
29% identity, 89% coverage: 45:406/408 of query aligns to 34:386/393 of 6l1nA
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
26% identity, 96% coverage: 15:407/408 of query aligns to 3:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
26% identity, 96% coverage: 15:407/408 of query aligns to 3:382/388 of 1gd9A
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
29% identity, 96% coverage: 15:407/408 of query aligns to 4:368/368 of 1v2fA
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
29% identity, 96% coverage: 15:407/408 of query aligns to 4:368/368 of 1v2eA
1j32A Aspartate aminotransferase from phormidium lapideum
26% identity, 90% coverage: 42:407/408 of query aligns to 30:384/388 of 1j32A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
27% identity, 91% coverage: 39:408/408 of query aligns to 28:383/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
27% identity, 90% coverage: 39:407/408 of query aligns to 28:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
27% identity, 90% coverage: 39:407/408 of query aligns to 28:382/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
27% identity, 90% coverage: 39:407/408 of query aligns to 28:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
27% identity, 90% coverage: 39:407/408 of query aligns to 28:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
27% identity, 90% coverage: 39:407/408 of query aligns to 28:382/382 of 1gc3A
Sites not aligning to the query:
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
25% identity, 96% coverage: 15:407/408 of query aligns to 4:396/402 of 5wmiA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
20% identity, 81% coverage: 74:403/408 of query aligns to 68:391/402 of P14909
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
25% identity, 96% coverage: 15:407/408 of query aligns to 3:396/399 of 5wmhA
>WP_012567937.1 NCBI__GCF_000016185.1:WP_012567937.1
MTGASPSQAPMPTGNPRLEGLTDYPFTRLAALLAGVPPRANLEPLSLAVGEPQHAPPALL
TEALQANARLWGRYPPVAGTPEFRAAVGDWLERRYALPPGFVDRETGILPVAGTREALFQ
LPLLTVPERRAGRRPAVLIPDPFYAVYEGAAAMAGAEPVFLPAFADTGFLPDLDAIPAEV
LERTALFFLCTPANPQGAVADLDYLRRALALARAYGFVLAVDECYAEIWDRAAPPGALEA
ARETGSTAGLVVLHSLSKRSSAAGLRSGFIAGDPGLLQRFARLRSYSCAGTPLPALAAAT
ALWRDEAHVEENRRLYRAKVDAADSVLAGRFGFYRPPGGFFLWLDVGDGEAAARTLWREA
AIRVLPGAYLSRSDADGGNRGRPYVRVALVHDAETVARACERIARLLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory