Comparing WP_012590192.1 NCBI__GCF_000021745.1:WP_012590192.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
37% identity, 89% coverage: 20:270/281 of query aligns to 19:263/265 of 6y88B
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
37% identity, 73% coverage: 65:270/281 of query aligns to 49:255/259 of 3t44A
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
37% identity, 73% coverage: 65:270/281 of query aligns to 49:255/258 of 3t55A
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
38% identity, 79% coverage: 49:270/281 of query aligns to 32:250/253 of 6y88G
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
36% identity, 73% coverage: 65:270/281 of query aligns to 49:253/257 of 3t78A
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
35% identity, 81% coverage: 43:271/281 of query aligns to 30:254/254 of 1vc4B
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
35% identity, 72% coverage: 72:274/281 of query aligns to 47:247/251 of 3t40A
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
35% identity, 73% coverage: 57:262/281 of query aligns to 38:239/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
35% identity, 73% coverage: 57:262/281 of query aligns to 38:239/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
35% identity, 73% coverage: 57:262/281 of query aligns to 38:239/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
35% identity, 73% coverage: 57:262/281 of query aligns to 38:239/247 of 1a53A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
32% identity, 76% coverage: 57:270/281 of query aligns to 38:246/247 of 4iwwA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
30% identity, 77% coverage: 55:270/281 of query aligns to 39:253/452 of 1piiA
Sites not aligning to the query:
3ud6A Structural analyses of covalent enzyme-substrate analogue complexes reveal strengths and limitations of de novo enzyme design (see paper)
32% identity, 76% coverage: 57:270/281 of query aligns to 38:246/248 of 3ud6A
3nz1A Crystal structure of kemp elimination catalyst 1a53-2 complexed with transition state analog 5-nitro benzotriazole (see paper)
32% identity, 77% coverage: 57:272/281 of query aligns to 38:249/249 of 3nz1A
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
30% identity, 74% coverage: 62:270/281 of query aligns to 46:253/259 of 1jcmP
Sites not aligning to the query:
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
32% identity, 76% coverage: 57:270/281 of query aligns to 38:246/247 of 3uxdA
6nw4A Evolution of a computationally designed kemp eliminase (see paper)
35% identity, 64% coverage: 84:262/281 of query aligns to 59:239/247 of 6nw4A
Sites not aligning to the query:
4a2rA Structure of the engineered retro-aldolase ra95.5-5 (see paper)
32% identity, 76% coverage: 57:270/281 of query aligns to 38:246/247 of 4a2rA
Sites not aligning to the query:
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
32% identity, 76% coverage: 57:270/281 of query aligns to 38:246/247 of 4ou1A
>WP_012590192.1 NCBI__GCF_000021745.1:WP_012590192.1
MSDPANYSAVGPRLKPLLEQRQADVEKAKVKRSGGSLTGAIGEAAKTAGFRAALFHHFAT
TGRPGVIADIQGASPLTKVTRSRLDVRDLAEDFRDAGAVCISAAQDRRLYRGSLADFTAA
KVAKLPILANDLVVDQYQIIEARYAGADAIVLIVGVLGRQLGDFLARADSVLLDCLVDVR
NEAELEIGLEAGANLIGVNNRDLETMEVDPSICERLIPQIPLDRVLAVASGGLKSLEDIN
RMKDLGAKAVRIAGALMEARDPYETLHQLLGTTPPEELEEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory