SitesBLAST
Comparing WP_012591387.1 NCBI__GCF_000021745.1:WP_012591387.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3vpdA Lysx from thermus thermophilus complexed with amp-pnp (see paper)
32% identity, 58% coverage: 90:276/321 of query aligns to 63:251/281 of 3vpdA
- binding phosphoaminophosphonic acid-adenylate ester: V127 (= V156), K129 (= K158), W135 (≠ Q164), G136 (= G165), L139 (≠ I171), Q169 (= Q190), V172 (≠ I193), K174 (≠ D198), D178 (= D202), R194 (= R218), W199 (= W223), T201 (= T225), F239 (≠ L264), E249 (= E274)
Sites not aligning to the query:
7qyrD Crystal structure of rimk from pseudomonas aeruginosa pao1 (see paper)
30% identity, 76% coverage: 62:305/321 of query aligns to 48:291/293 of 7qyrD
- binding adenosine-5'-diphosphate: V139 (= V156), Y179 (vs. gap), I180 (vs. gap), D187 (= D202), R211 (≠ I224), S212 (≠ T225), L250 (= L264), M259 (≠ L273)
- binding : R64 (= R76), R189 (= R204), N262 (= N276), S264 (≠ M278), G266 (= G280)
Sites not aligning to the query:
Q4JAP9 Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) (see paper)
28% identity, 86% coverage: 26:302/321 of query aligns to 3:275/276 of Q4JAP9
- NT 253:254 (≠ GL 283:284) mutation to GF: Alters substrate specificity, so that glutamate is preferred over alpha-aminoadipate.
5k2mI Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
31% identity, 62% coverage: 100:298/321 of query aligns to 67:265/273 of 5k2mI
- binding adenosine-5'-diphosphate: K83 (= K116), V120 (= V156), K122 (= K158), S127 (≠ A163), L132 (≠ I171), Q162 (= Q190), V165 (≠ I193), K167 (≠ G194), D171 (= D198), W192 (= W223), I193 (= I224), T194 (= T225), N195 (= N226), F231 (≠ L264), N240 (≠ L273), E241 (= E274)
- binding 2-aminohexanedioic acid: R173 (= R204), N195 (= N226), T196 (≠ I227), A197 (≠ K228), E247 (≠ G280), F248 (≠ W281), N250 (≠ G283)
- binding : F125 (= F161), W128 (≠ Q164), R130 (= R169), N153 (vs. gap), Y156 (vs. gap), N245 (≠ M278)
Sites not aligning to the query:
5k2mG Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
31% identity, 62% coverage: 100:298/321 of query aligns to 67:265/273 of 5k2mG
- binding adenosine-5'-diphosphate: K83 (= K116), V120 (= V156), K122 (= K158), S127 (≠ A163), G129 (= G165), Q162 (= Q190), V165 (≠ I193), K167 (≠ G194), D171 (= D198), W192 (= W223), T194 (= T225), N195 (= N226), F231 (≠ L264), N240 (≠ L273), E241 (= E274)
- binding magnesium ion: D229 (= D261), E241 (= E274)
- binding : F125 (= F161), S127 (≠ A163), W128 (≠ Q164), R130 (= R169), Y156 (vs. gap), R173 (= R204), R187 (= R218), T196 (≠ I227), A197 (≠ K228), N243 (= N276), P244 (≠ S277), N245 (≠ M278), E247 (≠ G280), F248 (≠ W281), N250 (≠ G283), A251 (≠ L284)
Sites not aligning to the query:
4iwxA Rimk structure at 2.85a (see paper)
27% identity, 76% coverage: 62:304/321 of query aligns to 50:292/294 of 4iwxA
- binding adenosine-5'-diphosphate: V141 (= V156), K143 (= K158), E180 (≠ R191), Y181 (≠ F192), I182 (= I193), K183 (≠ R196), D189 (= D202), R213 (≠ I224), S214 (≠ T225), N215 (= N226), M261 (≠ L273), E262 (= E274)
- binding glutamic acid: R98 (≠ I112), R104 (≠ A118), Q107 (≠ F121), L108 (≠ A122), R111 (≠ H125)
3vpbB Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate (see paper)
27% identity, 64% coverage: 100:303/321 of query aligns to 71:278/282 of 3vpbB
- binding adenosine-5'-diphosphate: K87 (= K116), I125 (≠ V156), K127 (= K158), S132 (≠ A163), G134 (= G165), V137 (≠ L168), Q167 (= Q190), Y169 (≠ F192), I170 (= I193), D176 (= D202), R200 (≠ I224), A201 (≠ T225), N202 (= N226), N249 (≠ L273), E250 (= E274)
- binding glutamic acid: Y190 (≠ M216), R192 (= R218), N202 (= N226), V203 (≠ I227), A204 (≠ K228), E256 (≠ G280), G259 (= G283)
- binding magnesium ion: D237 (= D261), E250 (= E274)
- binding zinc ion: E250 (= E274), N252 (= N276)
Q970U6 Glutamate--LysW ligase ArgX; EC 6.3.2.- from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
27% identity, 64% coverage: 100:303/321 of query aligns to 71:278/282 of Q970U6
- D237 (= D261) binding
- E250 (= E274) binding ; binding
- N252 (= N276) binding
5zctH The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
27% identity, 76% coverage: 62:304/321 of query aligns to 48:290/292 of 5zctH
- binding phosphoaminophosphonic acid-adenylate ester: V139 (= V156), K141 (= K158), Q177 (= Q190), Y179 (≠ F192), I180 (= I193), D187 (= D202), F210 (≠ W223), R211 (≠ I224), S212 (≠ T225), N213 (= N226), R216 (≠ L229), L250 (= L264), M259 (≠ L273), E260 (= E274)
- binding magnesium ion: D248 (= D261), E260 (= E274)
5zctA The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
27% identity, 76% coverage: 62:304/321 of query aligns to 48:290/292 of 5zctA
- binding phosphoaminophosphonic acid-adenylate ester: K100 (= K116), K141 (= K158), T146 (≠ A163), Q147 (= Q164), G148 (= G165), Q177 (= Q190), Y179 (≠ F192), I180 (= I193), R211 (≠ I224), S212 (≠ T225), N213 (= N226), L250 (= L264), M259 (≠ L273)
1uc9A Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 (see paper)
28% identity, 58% coverage: 90:276/321 of query aligns to 63:227/256 of 1uc9A
7drpA Structure of atp-grasp ligase psnb complexed with phosphomimetic variant of minimal precursor, mg, and adp (see paper)
28% identity, 65% coverage: 84:293/321 of query aligns to 100:305/312 of 7drpA
- binding adenosine-5'-diphosphate: K170 (= K158), T178 (≠ L168), Q202 (≠ L189), E203 (≠ Q190), L205 (≠ F192), D209 (= D202), K269 (≠ I263), L279 (= L273), E280 (= E274)
- binding magnesium ion: D267 (= D261), E280 (= E274), E280 (= E274), N282 (= N276)
- binding : Y169 (≠ L157), G175 (= G165), A176 (≠ F166), R179 (= R169), R190 (≠ P179), R193 (≠ A182), L194 (≠ V183), V199 (= V186), R211 (= R204), N282 (= N276), S284 (≠ M278), A285 (≠ P279), M286 (≠ G280)
Sites not aligning to the query:
7drnA Structure of atp-grasp ligase psnb complexed with precursor peptide psna2 and amppnp (see paper)
28% identity, 65% coverage: 84:293/321 of query aligns to 100:305/311 of 7drnA
- binding phosphoaminophosphonic acid-adenylate ester: K170 (= K158), T178 (≠ L168), Q202 (≠ L189), E203 (≠ Q190), L205 (≠ F192), D209 (= D202), K269 (≠ I263), L279 (= L273), E280 (= E274)
- binding : Y169 (≠ L157), P171 (= P159), G175 (= G165), A176 (≠ F166), R179 (= R169), R190 (≠ P179), R211 (= R204), S284 (≠ M278), M286 (≠ G280)
Sites not aligning to the query:
Query Sequence
>WP_012591387.1 NCBI__GCF_000021745.1:WP_012591387.1
MPASPKAALLGEGAPKIAIAVDLYDWHARDLTAAFARAGALATPIRLAQCGFDTQRKHGL
VIHGFGSDLPDAVFVRAIGSGSFESVTLRLSVLHALRDLGVPVANPARAVEICVDKAATS
FALAHAKIPTPPTWAAQSTDAARKILRREISRGPLVLKPLFGAQGFGLRLIQSEDDLPPI
EAVEYVYYLQRFIGPRKDVYSDMRFFVSDGKVIGAMIRRAANWITNIKLGARPEWLEPDD
ALTALALRASSAVGAQFAGVDIILDADGAPQVLEVNSMPGWRGLQKVAPFCVADRLVRDF
LKHAGRAPVEEAPTSSVERVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory