Comparing WP_012592297.1 NCBI__GCF_000021745.1:WP_012592297.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
37% identity, 92% coverage: 28:387/392 of query aligns to 21:389/393 of 1e5fA
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
37% identity, 93% coverage: 28:391/392 of query aligns to 21:394/394 of 1e5eA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 14:391/395 of 5m3zA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
37% identity, 92% coverage: 28:388/392 of query aligns to 20:371/373 of 4l0oH
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 6egrA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 3jw9A
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
36% identity, 94% coverage: 18:387/392 of query aligns to 15:392/396 of 4hf8A
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
37% identity, 96% coverage: 10:387/392 of query aligns to 2:393/397 of 3vk3A
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
37% identity, 96% coverage: 10:387/392 of query aligns to 3:394/398 of 1pg8A
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
37% identity, 96% coverage: 10:387/392 of query aligns to 3:394/398 of P13254
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
38% identity, 91% coverage: 31:387/392 of query aligns to 25:389/393 of 5x30C
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
38% identity, 91% coverage: 31:387/392 of query aligns to 24:388/392 of 5x2xA
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
38% identity, 91% coverage: 31:387/392 of query aligns to 24:388/392 of 5x2wA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
37% identity, 92% coverage: 28:387/392 of query aligns to 20:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
37% identity, 92% coverage: 28:387/392 of query aligns to 20:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
37% identity, 92% coverage: 28:387/392 of query aligns to 20:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
37% identity, 92% coverage: 28:387/392 of query aligns to 20:377/380 of 7mcqA
>WP_012592297.1 NCBI__GCF_000021745.1:WP_012592297.1
MNRVFIPPSGSEPATGSAGRTRAYALDAASPPIFQTSSFFFDNFDDMADVYAGRSRRLIY
SRGDNPTVMEFERVMAELDGAEAARAFSSGMGAIAATIIAFVSAGDRIVTVRNVYSDAYR
LFELVLAKFGVTVDYLDGADAGAIAAALPGAKLLYLETPTSLTFELQDIATLAALARAQG
VVSVIDNSWATPQFQKPIAHGVDLVIHAASKYLGGHSDTVAGVVSGSAEHVARINAGAYA
YLGAKLSPFEAWLLLRGLATLELRLPRHMQSGLLIAGRLKAHPNVSLVRHPAYSDHPGKA
TLSGFSGLFSIEVGENIDVRTFANALKLFRLGVSWGGPESLVVPALAPLQLRTANCFARF
GVSPRLIRLHVGLEDAEALWDDLERALALARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory