Comparing WP_012646712.1 NCBI__GCF_000022265.1:WP_012646712.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
52% identity, 99% coverage: 3:331/333 of query aligns to 7:334/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
48% identity, 99% coverage: 3:331/333 of query aligns to 3:327/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
48% identity, 99% coverage: 3:331/333 of query aligns to 4:328/333 of P38503
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
47% identity, 94% coverage: 18:331/333 of query aligns to 21:324/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
45% identity, 98% coverage: 6:331/333 of query aligns to 394:709/714 of Q8ZND6
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
37% identity, 95% coverage: 15:332/333 of query aligns to 437:744/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
35% identity, 99% coverage: 3:332/333 of query aligns to 430:755/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
28% identity, 44% coverage: 170:316/333 of query aligns to 129:271/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
28% identity, 44% coverage: 170:316/333 of query aligns to 127:269/285 of 3uf6A
Sites not aligning to the query:
>WP_012646712.1 NCBI__GCF_000022265.1:WP_012646712.1
MHLMEQIKAKAKKNLQTVVLPESYDERMLFAAQKIVEQGLAKIIILGNQTEVSAAAQNKG
VNLAGVEILDPATSPKLEAYIDALVELRKSKGLTREEARNLLTAKDYLYYAGMMVRLGDA
GGEVAGATGTTGNVLKAAFQTVGTAPGIKTVSSFFLMVTKNTDFGENGIVLFADCAVNPN
PDAQALAEIAVATARNCKSFLDVPARVAMLSFSTKGSAAHADVDKVLKALEIARGIDPSL
QIDGELQADAALLPKVGEKKAPGSPVAGKANVLVFPDLDAGNIAYKLVERVAGAEAIGPV
IQGLAKPVNDLSRGCSVDDIVNVAAITAVQAQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory