Comparing WP_012675785.1 NCBI__GCF_000021565.1:WP_012675785.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O66440 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Aquifex aeolicus (strain VF5) (see paper)
43% identity, 96% coverage: 8:227/229 of query aligns to 2:219/219 of O66440
Q6GII7 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Staphylococcus aureus (strain MRSA252) (see paper)
33% identity, 86% coverage: 29:225/229 of query aligns to 30:238/238 of Q6GII7
1sfjA 2.4a crystal structure of staphylococcus aureus type i 3- dehydroquinase, with 3-dehydroquinate bound (see paper)
33% identity, 86% coverage: 29:225/229 of query aligns to 24:227/227 of 1sfjA
6sfhA Crystal structure of dhq1 from staphylococcus aureus covalently modified by ligand 7 (see paper)
33% identity, 86% coverage: 29:225/229 of query aligns to 29:237/237 of 6sfhA
8b2aBBB 3-dehydroquinate dehydratase (see paper)
33% identity, 86% coverage: 29:225/229 of query aligns to 30:238/238 of 8b2aBBB
3js3A Crystal structure of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent reaction intermediate (see paper)
30% identity, 93% coverage: 7:218/229 of query aligns to 17:243/253 of 3js3A
Q186A6 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Clostridioides difficile (strain 630) (Peptoclostridium difficile) (see paper)
30% identity, 93% coverage: 7:218/229 of query aligns to 17:243/255 of Q186A6
4h3dB 1.95 angstrom crystal structure of of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent modified comenic acid.
30% identity, 93% coverage: 7:218/229 of query aligns to 17:243/254 of 4h3dB
1l9wA Crystal structure of 3-dehydroquinase from salmonella typhi complexed with reaction product (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 1l9wA
4clmB Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 15:241/251 of 4clmB
8b2cAAA 3-dehydroquinate dehydratase (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 8b2cAAA
8b2bAAA 3-dehydroquinate dehydratase (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 8b2bAAA
6sfeA Crystal structure of dhq1 from salmonella typhi covalently modified by compound 7 (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 6sfeA
6h5jA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 4
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 6h5jA
6h5gA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 3
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 6h5gA
6h5cA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 1
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 6h5cA
4cnpA Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-epiquinic acid derivative
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of 4cnpA
P24670 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Salmonella typhi (see 3 papers)
31% identity, 93% coverage: 7:218/229 of query aligns to 16:242/252 of P24670
4uioA Structure of the salmonella typhi type i dehydroquinase covalently inhibited by a 3-dehydroquinic acid derivative (see paper)
31% identity, 93% coverage: 7:218/229 of query aligns to 14:240/250 of 4uioA
4gujA 1.50 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with shikimate (see paper)
31% identity, 88% coverage: 17:218/229 of query aligns to 28:241/251 of 4gujA
>WP_012675785.1 NCBI__GCF_000021565.1:WP_012675785.1
MEIGKYPLIALPLDDRDLESKLSQAKSKGIDLIELRIDMFSSTQSDYVKDISRKVKDSGF
GIIGTVRSVEEGGLKDLKDSERIELFEAVSDYADIIDIELRSERLHEDLVKLCRDKEKFL
LVSYHDFEKTPSEDEIQEIIDRSSFGDIIKFAFMVKDVEDVGRILSVTHKNRDKKIVSIG
MGDLGKITRVAGFFFGSLITYTYIGESVAPGQIEVKELIKELKFYGLRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory