Comparing WP_012676051.1 NCBI__GCF_000021565.1:WP_012676051.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
34% identity, 90% coverage: 6:276/300 of query aligns to 12:293/295 of 6cyzA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
27% identity, 87% coverage: 3:262/300 of query aligns to 1:272/310 of P00547
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
31% identity, 94% coverage: 1:283/300 of query aligns to 1:288/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
31% identity, 94% coverage: 1:283/300 of query aligns to 1:288/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
31% identity, 94% coverage: 1:283/300 of query aligns to 1:288/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
31% identity, 94% coverage: 1:283/300 of query aligns to 1:288/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
31% identity, 94% coverage: 1:283/300 of query aligns to 1:288/296 of 1fwkA
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 56% coverage: 128:296/300 of query aligns to 191:364/370 of Q8L7R2
Sites not aligning to the query:
>WP_012676051.1 NCBI__GCF_000021565.1:WP_012676051.1
MKVLKVKVPATTANLGAGFDTLGLALTLYNEFIVEEHDGVVIETEPKNEFLEIPENNLFI
QVIKYACERRGKTFHGAKLKQINRVPVARGLGSSATAIVGAIVVSSAVSKTELTDDIFFD
IAYRFEPHPDNLIPAWKGGFITALKDREKTYYNSIDFPEDIKAVVVIPEFELSTEKARSV
LPERIPLRDGIFNVQRVSLFLSALQNRRYDLLRVAMEDRFHQPYRKKLIPNFDRVVQNGY
DAGALGVSLSGAGSAILALADRNFEEIGKAMTEGFSEAGIRSEYKILDIDREGANLEILE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory