SitesBLAST
Comparing WP_012676079.1 NCBI__GCF_000021565.1:WP_012676079.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
43% identity, 94% coverage: 22:437/441 of query aligns to 22:431/435 of Q5F8J4
- L45 (≠ R45) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ RN 45:46) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
38% identity, 99% coverage: 2:437/441 of query aligns to 3:429/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), L12 (≠ Y11), G13 (= G12), N14 (≠ V13), V15 (= V14), V45 (≠ T44), R46 (= R45), R47 (vs. gap), R52 (≠ K49), I63 (≠ L64), L78 (= L79), M79 (≠ T80), P84 (≠ F85), A102 (= A103), K104 (= K105), G306 (= G302), T310 (= T306)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
41% identity, 72% coverage: 1:318/441 of query aligns to 2:307/402 of 4pg7A
Sites not aligning to the query:
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
38% identity, 67% coverage: 1:295/441 of query aligns to 1:283/332 of 6a0tB
- active site: D191 (= D201), K195 (= K205)
- binding l-homoserine: N150 (= N159), G151 (= G160), T152 (= T161), Y178 (= Y188), E180 (= E190), D186 (= D196), K195 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G11 (≠ Y11), G12 (= G12), T13 (≠ V13), V14 (= V14), L42 (≠ F43), V43 (≠ T44), R44 (= R45), D45 (≠ N46), K48 (= K49), R50 (≠ Y53), A73 (≠ L79), M74 (≠ T80), G75 (= G81), A97 (= A103), N98 (= N104), G177 (= G187), E180 (= E190)
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
38% identity, 67% coverage: 1:295/441 of query aligns to 1:283/331 of 6a0sA
- active site: D191 (= D201), K195 (= K205)
- binding l-homoserine: K99 (= K105), N150 (= N159), G151 (= G160), T152 (= T161), Y178 (= Y188), E180 (= E190), D186 (= D196), K195 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ Y11), G12 (= G12), T13 (≠ V13), V14 (= V14), L42 (≠ F43), V43 (≠ T44), R44 (= R45), D45 (≠ N46), K48 (= K49), R50 (≠ Y53), A73 (≠ L79), M74 (≠ T80), A97 (= A103), K99 (= K105), G177 (= G187), E180 (= E190)
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
38% identity, 67% coverage: 1:295/441 of query aligns to 1:283/331 of 2ejwA
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
38% identity, 70% coverage: 8:315/441 of query aligns to 5:293/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ V9), G7 (= G10), Y8 (= Y11), G9 (= G12), N10 (≠ V13), V11 (= V14), T37 (≠ K31), R38 (≠ K32), R39 (≠ S33), V72 (≠ I75), S73 (≠ V76), S74 (≠ V77), T100 (≠ A103), K102 (= K105), G127 (≠ A130), S131 (≠ G134), E185 (= E190), G280 (= G302), A284 (≠ T306)
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
38% identity, 70% coverage: 8:315/441 of query aligns to 5:295/302 of 5x9dA
- active site: D196 (= D201), K200 (= K205)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ V9), G7 (= G10), Y8 (= Y11), G9 (= G12), N10 (≠ V13), V11 (= V14), T37 (≠ K31), R38 (≠ K32), V72 (≠ I75), S73 (≠ V76), S74 (≠ V77), P82 (≠ F85), T100 (≠ A103), N101 (= N104), K102 (= K105), G127 (≠ A130), S131 (≠ G134), N155 (= N159), G156 (= G160), T157 (= T161), Y183 (= Y188), A184 (= A189), E185 (= E190), D191 (= D196), D196 (= D201), K200 (= K205), A281 (= A301), G282 (= G302), A286 (≠ T306)
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
31% identity, 71% coverage: 3:315/441 of query aligns to 2:309/319 of 4xb1A
- active site: D211 (= D201), K215 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ V9), F10 (≠ Y11), G11 (= G12), T12 (≠ V13), V13 (= V14), D39 (≠ T44), R40 (= R45), K57 (vs. gap), V91 (≠ L79), S92 (≠ T80), S93 (≠ G81), S114 (≠ A103), K116 (= K105), S141 (≠ A130), G295 (≠ A301), T300 (= T306)
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
31% identity, 71% coverage: 3:315/441 of query aligns to 2:309/319 of 4xb2A
- active site: D211 (= D201), K215 (= K205)
- binding l-homoserine: A171 (≠ G160), S172 (≠ T161), D206 (= D196), K215 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ V9), F10 (≠ Y11), G11 (= G12), T12 (≠ V13), V13 (= V14), R40 (= R45), V91 (≠ L79), S92 (≠ T80), S93 (≠ G81), S114 (≠ A103), N115 (= N104), K116 (= K105), S141 (≠ A130), G295 (≠ A301), T300 (= T306)
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
32% identity, 52% coverage: 2:229/441 of query aligns to 1:237/319 of 3ingA
- active site: D209 (= D201), K213 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), T10 (≠ Y11), G11 (= G12), N12 (≠ V13), V13 (= V14), D38 (≠ I37), S39 (≠ N38), K57 (≠ P56), C85 (≠ L79), T86 (= T80), P87 (vs. gap), A112 (= A103), N113 (= N104), K114 (= K105), A139 (= A130), E198 (= E190), S199 (≠ A191)
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
32% identity, 55% coverage: 1:241/441 of query aligns to 1:247/321 of 3jsaA
- active site: D212 (= D201), K216 (= K205)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), L11 (≠ Y11), G12 (= G12), N13 (≠ V13), V14 (= V14), D42 (≠ N46), S43 (≠ W47), A90 (≠ L79), T91 (= T80), P92 (vs. gap), A117 (= A103), N118 (= N104), A144 (= A130)
Sites not aligning to the query:
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 56% coverage: 74:318/441 of query aligns to 643:909/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 36% coverage: 57:213/441 of query aligns to 72:239/376 of O94671
- S201 (≠ D175) modified: Phosphoserine
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 48% coverage: 2:213/441 of query aligns to 4:231/359 of P31116
- 11:18 (vs. 9:16, 63% identical) binding
- T93 (= T80) binding
- K117 (= K105) binding
- E208 (= E190) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D201) mutation to L: Reduces kcat 150-fold.
- K223 (= K205) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
28% identity, 48% coverage: 2:213/441 of query aligns to 3:230/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
28% identity, 48% coverage: 2:213/441 of query aligns to 3:230/358 of 1q7gA
- active site: D218 (= D201), K222 (= K205)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G12), V14 (= V13), V15 (= V14), E39 (vs. gap), N91 (≠ L79), T92 (= T80), S93 (≠ G81), I97 (≠ P86), P114 (≠ A103), K116 (= K105), A143 (= A130), S173 (≠ N159), K222 (= K205)
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
28% identity, 48% coverage: 2:213/441 of query aligns to 3:230/358 of 1ebuD
- active site: D218 (= D201), K222 (= K205)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G10), A12 (≠ Y11), G13 (= G12), V14 (= V13), V15 (= V14), E39 (vs. gap), A40 (vs. gap), N91 (≠ L79), S93 (≠ G81), K116 (= K105)
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
28% identity, 48% coverage: 2:213/441 of query aligns to 3:230/358 of 1ebfA
- active site: D218 (= D201), K222 (= K205)
- binding nicotinamide-adenine-dinucleotide: I10 (≠ V9), A12 (≠ Y11), G13 (= G12), V14 (= V13), V15 (= V14), E39 (vs. gap), A40 (vs. gap), T92 (= T80), S93 (≠ G81), P114 (≠ A103)
Query Sequence
>WP_012676079.1 NCBI__GCF_000021565.1:WP_012676079.1
MKRIDIGLVGYGVVGNGVARILEEKKELLSKKSGVEINLKKVFTRNWNKSFPYPLPESKK
AYSLDEILQDDDISIVVELTGGIDFPYKLISEAVEKGKHVVTANKALLAERGKEIFLKAE
QKDIRIGYEAAVAGGIPIIRALREGLIANDIIKIYGILNGTTNYILTSMYKQGKDFKTAL
REAQELGYAEADPTLDINGTDAAHKITILASLSYGGFLDFSQVYVEGIESIHPLDIELGK
DLGYVLKLLAIAKGHNGEVEVRVHPTFIPEDNPLAKVDGVFNAVMVEGDAVGESMFYGKG
AGSLPTASAVISDIVDISKSIAEGVGRGIEITSMNWEHKDLTLTRVPDFYTRYYLRFTVP
DVTGILAKVAAVFARFNISIAAVIQKEKVVSMYESKEKVVPLVILTHTASENNIQKAIKE
IEQQGITVEKTVIIRVEDEEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory