SitesBLAST
Comparing WP_012676927.1 NCBI__GCF_000021565.1:WP_012676927.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
63% identity, 99% coverage: 3:480/485 of query aligns to 2:474/478 of 3h0mA
- active site: K72 (= K79), S147 (= S154), S148 (= S155), S166 (= S173), T168 (= T175), G169 (= G176), G170 (= G177), S171 (= S178), Q174 (= Q181)
- binding glutamine: M122 (= M129), G123 (= G130), D167 (= D174), T168 (= T175), G169 (= G176), G170 (= G177), S171 (= S178), F199 (= F206), Y302 (= Y309), R351 (= R358), D418 (= D425)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
63% identity, 99% coverage: 3:480/485 of query aligns to 2:474/478 of 3h0lA
- active site: K72 (= K79), S147 (= S154), S148 (= S155), S166 (= S173), T168 (= T175), G169 (= G176), G170 (= G177), S171 (= S178), Q174 (= Q181)
- binding asparagine: G123 (= G130), S147 (= S154), G169 (= G176), G170 (= G177), S171 (= S178), Y302 (= Y309), R351 (= R358), D418 (= D425)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
54% identity, 97% coverage: 1:472/485 of query aligns to 1:472/485 of 2f2aA
- active site: K79 (= K79), S154 (= S154), S155 (= S155), S173 (= S173), T175 (= T175), G176 (= G176), G177 (= G177), S178 (= S178), Q181 (= Q181)
- binding glutamine: G130 (= G130), S154 (= S154), D174 (= D174), T175 (= T175), G176 (= G176), S178 (= S178), F206 (= F206), Y309 (= Y309), Y310 (= Y310), R358 (= R358), D425 (= D425)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
54% identity, 97% coverage: 1:472/485 of query aligns to 1:472/485 of 2dqnA
- active site: K79 (= K79), S154 (= S154), S155 (= S155), S173 (= S173), T175 (= T175), G176 (= G176), G177 (= G177), S178 (= S178), Q181 (= Q181)
- binding asparagine: M129 (= M129), G130 (= G130), T175 (= T175), G176 (= G176), S178 (= S178), Y309 (= Y309), Y310 (= Y310), R358 (= R358), D425 (= D425)
3kfuE Crystal structure of the transamidosome (see paper)
47% identity, 96% coverage: 9:472/485 of query aligns to 3:453/468 of 3kfuE
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
35% identity, 88% coverage: 49:473/485 of query aligns to 3:450/450 of 4n0iA
- active site: K38 (= K79), S116 (= S154), S117 (= S155), T135 (≠ S173), T137 (= T175), G138 (= G176), G139 (= G177), S140 (= S178), L143 (≠ Q181)
- binding glutamine: G89 (= G130), T137 (= T175), G138 (= G176), S140 (= S178), Y168 (≠ F206), Y271 (= Y309), Y272 (= Y310), R320 (= R358), D404 (= D425)
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
33% identity, 84% coverage: 71:476/485 of query aligns to 87:500/508 of 3a1iA
- active site: K95 (= K79), S170 (= S154), S171 (= S155), G189 (≠ S173), Q191 (≠ T175), G192 (= G176), G193 (= G177), A194 (≠ S178), I197 (≠ Q181)
- binding benzamide: F145 (≠ M129), S146 (≠ G130), G147 (≠ S131), Q191 (≠ T175), G192 (= G176), G193 (= G177), A194 (≠ S178), W327 (≠ Y309)
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
31% identity, 95% coverage: 8:469/485 of query aligns to 8:472/487 of 1m21A
- active site: K81 (= K79), S160 (= S154), S161 (= S155), T179 (≠ S173), T181 (= T175), D182 (≠ G176), G183 (= G177), S184 (= S178), C187 (≠ Q181)
- binding : A129 (= A128), N130 (≠ M129), F131 (≠ G130), C158 (≠ G152), G159 (= G153), S160 (= S154), S184 (= S178), C187 (≠ Q181), I212 (≠ F206), R318 (≠ Y310), L321 (≠ A313), L365 (≠ M360), F426 (vs. gap)
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
33% identity, 94% coverage: 10:467/485 of query aligns to 5:442/457 of 6c6gA
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 94% coverage: 25:480/485 of query aligns to 155:595/607 of Q7XJJ7
- K205 (= K79) mutation to A: Loss of activity.
- SS 281:282 (= SS 154:155) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 175:178) binding
- S305 (= S178) mutation to A: Loss of activity.
- R307 (= R180) mutation to A: Loss of activity.
- S360 (≠ K233) mutation to A: No effect.
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
29% identity, 94% coverage: 25:480/485 of query aligns to 155:595/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A128), T258 (≠ S131), S281 (= S154), G302 (≠ T175), G303 (= G176), S305 (= S178), S472 (≠ T363), I532 (≠ L419), M539 (vs. gap)
Sites not aligning to the query:
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
28% identity, 97% coverage: 2:470/485 of query aligns to 24:484/507 of Q84DC4
- T31 (≠ K9) mutation to I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- K100 (= K79) mutation to A: Abolishes activity on mandelamide.
- S180 (= S154) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S155) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G176) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S178) mutation to A: Abolishes activity on mandelamide.
- Q207 (= Q181) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (≠ I306) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ D372) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (= I426) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
28% identity, 98% coverage: 4:480/485 of query aligns to 5:480/490 of 4yjiA
- active site: K79 (= K79), S158 (= S154), S159 (= S155), G179 (≠ T175), G180 (= G176), G181 (= G177), A182 (≠ S178)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (≠ N81), G132 (≠ A128), S158 (= S154), G179 (≠ T175), G180 (= G176), A182 (≠ S178)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
30% identity, 87% coverage: 60:480/485 of query aligns to 72:467/605 of Q936X2
- K91 (= K79) mutation to A: Loss of activity.
- S165 (= S154) mutation to A: Loss of activity.
- S189 (= S178) mutation to A: Loss of activity.
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
31% identity, 88% coverage: 49:474/485 of query aligns to 45:439/461 of 4gysB
- active site: K72 (= K79), S146 (= S154), S147 (= S155), T165 (≠ S173), T167 (= T175), A168 (≠ G176), G169 (= G177), S170 (= S178), V173 (≠ Q181)
- binding malonate ion: A120 (= A128), G122 (= G130), S146 (= S154), T167 (= T175), A168 (≠ G176), S170 (= S178), S193 (≠ Y201), G194 (= G202), V195 (≠ L203), R200 (≠ S208), Y297 (= Y310), R305 (≠ S319)
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
24% identity, 98% coverage: 2:474/485 of query aligns to 1:445/457 of 5h6sC
- active site: K77 (= K79), S152 (= S154), S153 (= S155), L173 (≠ T175), G174 (= G176), G175 (= G177), S176 (= S178)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A128), R128 (≠ G130), W129 (≠ S131), S152 (= S154), L173 (≠ T175), G174 (= G176), S176 (= S178), W306 (≠ Y309), F338 (≠ Y343)
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
33% identity, 54% coverage: 1:263/485 of query aligns to 1:259/482 of 3a2qA
- active site: K69 (= K79), S147 (= S154), S148 (= S155), N166 (≠ S173), A168 (≠ T175), A169 (≠ G176), G170 (= G177), A171 (≠ S178), I174 (≠ Q181)
- binding 6-aminohexanoic acid: G121 (≠ A128), G121 (≠ A128), N122 (≠ M129), S147 (= S154), A168 (≠ T175), A168 (≠ T175), A169 (≠ G176), A171 (≠ S178)
Sites not aligning to the query:
Q9FR37 Amidase 1; AtAMI1; Translocon at the outer membrane of chloroplasts 64-I; AtTOC64-I; EC 3.5.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 83% coverage: 71:472/485 of query aligns to 28:421/425 of Q9FR37
- K36 (= K79) active site, Charge relay system; mutation to A: Loss of catalytic activity.; mutation to R: Reduces catalytic activity 10-fold.
- S113 (= S154) active site, Charge relay system; mutation S->A,T: Loss of catalytic activity.
- S114 (= S155) mutation to A: Loss of catalytic activity.; mutation to T: Reduces catalytic activity 400-fold.
- D133 (= D174) mutation to A: Loss of catalytic activity.; mutation to E: Reduces catalytic activity 600-fold.
- S137 (= S178) active site, Acyl-ester intermediate; mutation to A: Reduces catalytic activity 170-fold.; mutation to T: Loss of catalytic activity.
- C145 (= C186) mutation C->A,S: Reduces catalytic activity 10-fold.
- S214 (≠ G262) mutation to T: Slightly reduces catalytic activity.
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
28% identity, 93% coverage: 7:458/485 of query aligns to 3:392/412 of 1o9oA
- active site: K62 (= K79), A131 (≠ S154), S132 (= S155), T150 (≠ S173), T152 (= T175), G153 (= G176), G154 (= G177), S155 (= S178), R158 (≠ Q181)
- binding 3-amino-3-oxopropanoic acid: G130 (= G153), T152 (= T175), G153 (= G176), G154 (= G177), S155 (= S178), R158 (≠ Q181), P359 (= P418)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
28% identity, 93% coverage: 7:458/485 of query aligns to 3:392/412 of 1ocmA
- active site: K62 (= K79), S131 (= S154), S132 (= S155), T152 (= T175), G153 (= G176), G154 (= G177), S155 (= S178)
- binding pyrophosphate 2-: R113 (≠ G130), S131 (= S154), Q151 (≠ D174), T152 (= T175), G153 (= G176), G154 (= G177), S155 (= S178), R158 (≠ Q181), P359 (= P418)
Query Sequence
>WP_012676927.1 NCBI__GCF_000021565.1:WP_012676927.1
MELWKRSIKELKELIEKKEVKPSEVIESFAQRTKDVEVKIKSYVTDLTEQAVERAKQLDE
KISDLSEIPELFGIPIAIKDNISTEGIRTTCSSKILENYVPPFDATVIKRLKDKEYVITG
KTNLDEFAMGSSTENSAFFVTRNPWDLDRVPGGSSGGSAAAVSAGLAPAALGSDTGGSIR
QPAAFCGVIGLKPTYGRVSRYGLVAFASSLDQIGTFTRTVEDTAILLNIISGKDPKDSTS
ADREVPDFTKFLDKDIKGIKIGIPEEFFVEGLDSQIKELVMESAKLLEKEGAELVSISMP
TTKYAIEAYYIIAPSEASSNLARYDGVRYGFRASDYSDLEEMYSKTRDEGFGAEVKRRIM
LGTYSLSSGYYDAYYLKAQKVRTLIYQDFMKAFESVDIILTPTTPDVAFRIGEKVDDPLQ
MYLSDIFTVSVNMAGVPGMSIPCGFKDGLPVGMQLIGKPFDEGTIIQVADRFTKLKDFSK
DFPQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory