SitesBLAST
Comparing WP_012784170.1 NCBI__GCF_000023265.1:WP_012784170.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
37% identity, 78% coverage: 59:295/303 of query aligns to 74:322/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
37% identity, 78% coverage: 59:295/303 of query aligns to 70:318/324 of 2gcgA
- active site: L103 (≠ H90), R241 (= R219), D265 (= D242), E270 (= E247), H289 (= H266)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ T67), V79 (≠ A68), G80 (= G69), R241 (= R219), H289 (= H266)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A68), T107 (= T94), G156 (= G138), G158 (= G140), I160 (= I142), G180 (≠ A161), R181 (= R162), R184 (= R165), C212 (≠ V190), S213 (≠ P191), T218 (= T196), I239 (≠ V217), R241 (= R219), D265 (= D242), H289 (= H266), G291 (= G268)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
35% identity, 78% coverage: 63:299/303 of query aligns to 62:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ T67), R226 (= R219), H274 (= H266), Y282 (≠ L274)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ T67), A67 (= A68), G68 (= G69), H91 (= H90), Y282 (≠ L274)
- binding magnesium ion: F212 (≠ L205), E213 (≠ A206), M215 (≠ L208), D243 (≠ R236)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R87), L143 (≠ Y139), G144 (= G140), T145 (≠ A141), L146 (≠ I142), R165 (≠ A161), R166 (= R162), S167 (≠ T163), P180 (≠ F173), T197 (≠ V190), P198 (= P191), T203 (= T196), V224 (= V217), A225 (= A218), R226 (= R219), H274 (= H266), S276 (≠ G268)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
35% identity, 78% coverage: 63:299/303 of query aligns to 62:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ T67), A67 (= A68), G68 (= G69), H91 (= H90), R226 (= R219), H274 (= H266), Y282 (≠ L274)
- binding magnesium ion: T132 (≠ S128), A134 (= A130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R87), L143 (≠ Y139), G144 (= G140), T145 (≠ A141), L146 (≠ I142), R165 (≠ A161), R166 (= R162), S167 (≠ T163), P180 (≠ F173), T197 (≠ V190), P198 (= P191), T203 (= T196), V224 (= V217), A225 (= A218), R226 (= R219), H274 (= H266), S276 (≠ G268)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
35% identity, 78% coverage: 63:299/303 of query aligns to 62:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ T67), A67 (= A68), G68 (= G69), H91 (= H90), R226 (= R219), H274 (= H266), Y282 (≠ L274)
- binding magnesium ion: T132 (≠ S128), A134 (= A130), F212 (≠ L205), E213 (≠ A206), M215 (≠ L208), D243 (≠ R236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R87), G142 (= G138), L143 (≠ Y139), G144 (= G140), T145 (≠ A141), L146 (≠ I142), R165 (≠ A161), R166 (= R162), S167 (≠ T163), T197 (≠ V190), P198 (= P191), T203 (= T196), V224 (= V217), A225 (= A218), R226 (= R219), H274 (= H266), S276 (≠ G268)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
35% identity, 78% coverage: 63:299/303 of query aligns to 60:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ T67), A65 (= A68), G66 (= G69), H89 (= H90), R224 (= R219), H272 (= H266), Y280 (≠ L274)
- binding magnesium ion: T130 (≠ S128), A132 (= A130), F210 (≠ L205), E211 (≠ A206), M213 (≠ L208), G225 (= G220), P226 (= P221), V228 (= V223), E230 (≠ T225), D241 (≠ R236), S251 (≠ D245)
- binding nicotinamide-adenine-dinucleotide: A65 (= A68), G66 (= G69), T86 (≠ R87), H89 (= H90), G142 (= G140), T143 (≠ A141), L144 (≠ I142), R164 (= R162), P196 (= P191), T201 (= T196), V222 (= V217), A223 (= A218), R224 (= R219), H272 (= H266), S274 (≠ G268)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
33% identity, 83% coverage: 45:296/303 of query aligns to 51:307/311 of 3bazA
- active site: L98 (≠ H90), R230 (= R219), A251 (= A239), D254 (= D242), E259 (= E247), H277 (= H266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A68), G149 (= G138), L150 (≠ Y139), G151 (= G140), R152 (≠ A141), I153 (= I142), S172 (≠ A161), R173 (= R162), S174 (≠ T163), C201 (≠ V190), P202 (= P191), T207 (= T196), I228 (≠ V217), G229 (≠ A218), R230 (= R219), D254 (= D242), H277 (= H266), G279 (= G268)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
33% identity, 83% coverage: 45:296/303 of query aligns to 53:309/313 of Q65CJ7
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
42% identity, 68% coverage: 95:299/303 of query aligns to 103:309/315 of 5vg6B
- active site: R230 (= R219), D254 (= D242), E259 (= E247), H278 (= H266)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L147 (≠ Y139), G148 (= G140), D149 (≠ A141), L150 (≠ I142), W168 (≠ V160), S169 (≠ A161), R170 (= R162), T171 (= T163), K173 (≠ R165), L201 (≠ V190), P202 (= P191), T207 (= T196), V228 (= V217), R230 (= R219), H278 (= H266), A280 (≠ G269), S281 (≠ D270)
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 70% coverage: 80:292/303 of query aligns to 90:314/334 of 5aovA
- active site: L100 (≠ H90), R241 (= R219), D265 (= D242), E270 (= E247), H288 (= H266)
- binding glyoxylic acid: R241 (= R219), H288 (= H266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T104 (= T94), F158 (≠ Y139), G159 (= G140), R160 (≠ A141), I161 (= I142), S180 (≠ A161), R181 (= R162), A211 (≠ V189), V212 (= V190), P213 (= P191), T218 (= T196), I239 (≠ V217), A240 (= A218), R241 (= R219), H288 (= H266), G290 (= G268)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
37% identity, 57% coverage: 119:292/303 of query aligns to 128:313/332 of 6biiA
- active site: R240 (= R219), D264 (= D242), E269 (= E247), H287 (= H266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G138), F157 (≠ Y139), G158 (= G140), R159 (≠ A141), I160 (= I142), A179 (= A161), R180 (= R162), S181 (≠ T163), K183 (≠ R165), V211 (= V190), P212 (= P191), E216 (≠ A195), T217 (= T196), V238 (= V217), A239 (= A218), R240 (= R219), D264 (= D242), H287 (= H266), G289 (= G268)
Sites not aligning to the query:
Q9S7E4 Formate dehydrogenase, chloroplastic/mitochondrial; FDH; NAD-dependent formate dehydrogenase; EC 1.17.1.9 from Arabidopsis thaliana (Mouse-ear cress)
31% identity, 57% coverage: 128:299/303 of query aligns to 194:373/384 of Q9S7E4
Sites not aligning to the query:
- 1:29 modified: transit peptide, Chloroplast and mitochondrion
3n7uA NAD-dependent formate dehydrogenase from higher-plant arabidopsis thaliana in complex with NAD and azide
31% identity, 57% coverage: 128:299/303 of query aligns to 161:340/351 of 3n7uA
- active site: R257 (= R219), D281 (= D242), Q286 (≠ E247), H305 (= H266)
- binding azide ion: R257 (= R219), H305 (= H266)
- binding nicotinamide-adenine-dinucleotide: G173 (= G140), R174 (≠ A141), I175 (= I142), D194 (vs. gap), R195 (= R159), M228 (≠ V190), P229 (= P191), N255 (≠ V217), A256 (= A218), R257 (= R219), D281 (= D242), H305 (= H266), S307 (≠ G268), G308 (= G269)
Sites not aligning to the query:
3jtmA Structure of recombinant formate dehydrogenase from arabidopsis thaliana
31% identity, 57% coverage: 128:299/303 of query aligns to 161:340/351 of 3jtmA
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
29% identity, 83% coverage: 16:267/303 of query aligns to 23:276/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (≠ T67), A65 (= A68), G66 (= G69), R227 (= R219), H275 (= H266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A68), R89 (≠ G88), M99 (≠ T94), A144 (≠ Y139), G145 (= G140), V146 (≠ A141), L147 (≠ I142), W165 (≠ V160), S166 (≠ A161), R167 (= R162), T168 (= T163), K170 (≠ R165), L198 (≠ V190), P199 (= P191), L225 (≠ V217), R227 (= R219), H275 (= H266)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
29% identity, 83% coverage: 16:267/303 of query aligns to 23:276/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A68), R89 (≠ G88), M99 (≠ T94), A144 (≠ Y139), G145 (= G140), V146 (≠ A141), L147 (≠ I142), W165 (≠ V160), S166 (≠ A161), R167 (= R162), T168 (= T163), K170 (≠ R165), L198 (≠ V190), P199 (= P191), L225 (≠ V217), R227 (= R219), H275 (= H266)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: A65 (= A68), R227 (= R219), H275 (= H266)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
29% identity, 83% coverage: 16:267/303 of query aligns to 24:277/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A68), R90 (≠ G88), M100 (≠ T94), A145 (≠ Y139), G146 (= G140), V147 (≠ A141), L148 (≠ I142), W166 (≠ V160), S167 (≠ A161), R168 (= R162), T169 (= T163), K171 (≠ R165), L199 (≠ V190), P200 (= P191), L226 (≠ V217), A227 (= A218), R228 (= R219), D252 (= D242), H276 (= H266)
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
33% identity, 71% coverage: 79:292/303 of query aligns to 85:304/304 of 1wwkA
- active site: S96 (≠ H90), R230 (= R219), D254 (= D242), E259 (= E247), H278 (= H266)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T94), G146 (= G138), F147 (≠ Y139), G148 (= G140), R149 (≠ A141), I150 (= I142), Y168 (vs. gap), D169 (vs. gap), P170 (vs. gap), V201 (= V190), P202 (= P191), T207 (= T196), T228 (≠ V217), S229 (≠ A218), D254 (= D242), H278 (= H266), G280 (= G268)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
33% identity, 79% coverage: 54:291/303 of query aligns to 61:302/316 of 4zqbB
- active site: L99 (≠ G88), R231 (= R219), E260 (= E247), H279 (= H266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ T82), M103 (≠ D92), G147 (= G138), L148 (≠ Y139), G149 (= G140), E150 (≠ A141), L151 (≠ I142), W169 (≠ V160), S170 (≠ A161), R171 (= R162), S172 (≠ T163), K174 (≠ R165), L202 (≠ V190), P203 (= P191), F229 (≠ V217), R231 (= R219), H279 (= H266), S281 (≠ D270), A282 (≠ V271)
Sites not aligning to the query:
6ttbA Crystal structure of NAD-dependent formate dehydrogenase from staphylococcus aureus in complex with NAD
28% identity, 91% coverage: 21:295/303 of query aligns to 39:321/331 of 6ttbA
- binding nicotinamide-adenine-dinucleotide: V87 (= V70), N111 (≠ H90), V115 (≠ T94), F162 (≠ I137), G165 (= G140), R166 (≠ A141), I167 (= I142), Y185 (≠ V160), D186 (≠ A161), P187 (≠ R162), H214 (≠ V189), A215 (≠ V190), P216 (= P191), T221 (= T196), T242 (≠ V217), A243 (= A218), R244 (= R219), H292 (= H266), S294 (≠ G268), G295 (= G269)
Query Sequence
>WP_012784170.1 NCBI__GCF_000023265.1:WP_012784170.1
MQIVVPTALTELITRIPDAPIVTWDPGDPIDDRLAMTTFFVPAYAAGGAALEPLPRMRHL
EVLQLLTAGVDRVVGQIGEGVTLCNARGVHDDATAELAVALLLAATRGLSEFALAQHEGR
WERRVMPSLAGARVAIIGYGAIGRAIEARLAPFGVEIVRVARTPRFNPDVLAFDEFAPIL
PTLAGIVVVVPLTDATRHLIDAALLARLPDGAVVVNVARGPVVDTEALVAELASGRLRAG
LDVTDPEPLPPFHPLWHLPNVVLTPHVGGDVAGLETRASALVERNVRRYMAGLPLLNVVR
GEY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory