Comparing WP_012851395.1 NCBI__GCF_000024385.1:WP_012851395.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
40% identity, 64% coverage: 114:324/329 of query aligns to 5:224/255 of Q9X015
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
41% identity, 62% coverage: 120:324/329 of query aligns to 7:231/263 of P0AEY3
Sites not aligning to the query:
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
47% identity, 56% coverage: 91:275/329 of query aligns to 72:242/324 of A0R3C4
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 62% coverage: 68:272/329 of query aligns to 48:236/325 of P96379
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
34% identity, 62% coverage: 120:324/329 of query aligns to 6:198/225 of 3crcA
Sites not aligning to the query:
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
55% identity, 29% coverage: 114:208/329 of query aligns to 84:177/177 of 7yh5B
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
32% identity, 62% coverage: 120:324/329 of query aligns to 6:190/220 of 3crcB
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
29% identity, 32% coverage: 120:224/329 of query aligns to 5:108/114 of 2yxhA
>WP_012851395.1 NCBI__GCF_000024385.1:WP_012851395.1
MGLTVLATTHRVPAGLLSWRAWQALRSADRVLARDGQPQLPYLREADVAVEIVERTEAGP
LAELLVRAAADRAVVWVADPDGDEELMRRVGELVVAAPEPVEVEVLHGSYDLPGARLLDL
VSVMDTLRRQCPWDRKQTHATLVPYLLEEAYELADTVEDGDYAALREELGDVLMQVVFHA
RVAEERTDDTRFTIDDVAAGIVDKLVRRHPHVFGDVTVADADEVNANWEQIKAAERAAKG
EKASILDGVAMGQPALSLAAQLQRRAARAGVPQEVWRELAEESGEELGVELFELVRRARE
AGRDPEAALRTVARAYAARVRQWESSRKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory