SitesBLAST
Comparing WP_012855185.1 NCBI__GCF_000024385.1:WP_012855185.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
44% identity, 96% coverage: 6:343/351 of query aligns to 7:338/346 of Q04797
- S98 (≠ G97) modified: Phosphoserine
- Y146 (= Y146) modified: Phosphotyrosine
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
49% identity, 98% coverage: 5:347/351 of query aligns to 3:342/342 of 3tz6A
- active site: C129 (= C130), Q156 (= Q157), R248 (= R249), H255 (= H256)
- binding cysteine: C129 (= C130), Q156 (= Q157), G160 (= G161), E223 (= E224), R248 (= R249), H255 (= H256)
- binding glycerol: S108 (≠ P110), G187 (≠ A187), F192 (= F201), P201 (= P204), Q225 (≠ M226), R228 (= R229), F229 (≠ N230), Q335 (= Q340), E338 (= E343), L339 (= L344)
- binding sulfate ion: R98 (= R100), H117 (≠ R118), R119 (= R120), N128 (= N129), C129 (= C130), K226 (= K227), E270 (≠ R271), R273 (≠ Q274)
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (≠ T73), T75 (≠ V77), G160 (= G163), M161 (≠ Q164), G162 (≠ A165)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R100), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E224), K222 (= K227), R244 (= R249)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (≠ P74), S73 (≠ D75), T94 (≠ S96), S95 (≠ G97), R98 (= R100), K222 (= K227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), N93 (= N95), T94 (≠ S96), N126 (= N129), C127 (= C130), G160 (= G163), G328 (= G333)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (≠ D72), G72 (≠ P74), S73 (≠ D75), N93 (= N95), T94 (≠ S96), S95 (≠ G97), R98 (= R100), K222 (= K227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (≠ T73), G160 (= G163), M161 (≠ Q164), G162 (≠ A165)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 4r3nA
- active site: C127 (= C130), Q154 (= Q157), R244 (= R249), H251 (= H256)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ D75), T94 (≠ S96), S95 (≠ G97), R98 (= R100), N126 (= N129), K222 (= K227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), N93 (= N95), T94 (≠ S96), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ Q164), G328 (= G333)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R100), N126 (= N129), G158 (= G161), I208 (≠ A213), E219 (= E224), K222 (= K227), R244 (= R249)
- binding adenosine-2'-5'-diphosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (≠ T73), T75 (≠ V77), G160 (= G163), M161 (≠ Q164)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (≠ T73), T75 (≠ V77), G160 (= G163)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R100), N126 (= N129), G158 (= G161), A159 (= A162), E219 (= E224), K222 (= K227), R244 (= R249)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 2gz3A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R249), H251 (= H256)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E224), R244 (= R249), H251 (= H256)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), N93 (= N95), G158 (= G161), G160 (= G163), M161 (≠ Q164), N324 (= N329), A329 (= A334)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 2gz2A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R249), H251 (= H256)
- binding adenosine-2'-5'-diphosphate: G8 (= G10), T10 (= T12), G11 (= G13), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), A71 (≠ T73), T75 (≠ V77)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/357 of 2gz1A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R249), H251 (= H256)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), N93 (= N95), S157 (= S160), G158 (= G161), G160 (= G163), M161 (≠ Q164), N324 (= N329), L325 (= L330)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), N93 (= N95), T94 (≠ S96), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ Q164), G328 (= G333)
- binding phthalic acid: S73 (≠ D75), T94 (≠ S96), S95 (≠ G97), R98 (= R100), N126 (= N129), K222 (= K227)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ D75), T94 (≠ S96), S95 (≠ G97), R98 (= R100), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), K222 (= K227), R244 (= R249), H251 (= H256)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), N93 (= N95), T94 (≠ S96), P125 (= P128), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ Q164), G328 (= G333)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S96), S95 (≠ G97), R98 (= R100), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E224), K222 (= K227), R244 (= R249), H251 (= H256)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), N93 (= N95), T94 (≠ S96), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ Q164), G328 (= G333)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R100), G158 (= G161), E219 (= E224), K222 (= K227), R244 (= R249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), T10 (= T12), G11 (= G13), A12 (= A14), V13 (= V15), A35 (= A37), S36 (= S38), R38 (= R40), S39 (= S41), T56 (≠ L58), S70 (≠ D72), A71 (≠ T73), G72 (≠ P74), T75 (≠ V77), C127 (= C130), S157 (= S160), G158 (= G161), G160 (= G163), M161 (≠ Q164), N324 (= N329), L325 (= L330)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
41% identity, 97% coverage: 5:343/351 of query aligns to 3:338/361 of 3pylC
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
41% identity, 97% coverage: 5:345/351 of query aligns to 5:331/336 of 2r00C
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
41% identity, 97% coverage: 5:345/351 of query aligns to 6:332/337 of P23247
- C132 (= C130) active site, Acyl-thioester intermediate
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 78% coverage: 3:277/351 of query aligns to 8:271/354 of Q57658
Sites not aligning to the query:
Query Sequence
>WP_012855185.1 NCBI__GCF_000024385.1:WP_012855185.1
MSKPTLAVVGATGAVGSVMLELLSTREDVYGEIRLVASPRSAGKKLTVRGEQLEVLALAP
EVFEGVDIAMFDTPDEVSKQWAPIAAEHGAVAVDNSGAFRMDPDVPLVVPEVNAEAARNR
PKGIISNPNCTTLSMIVAMGALHRRYGLRELVVASYQAASGAGQAGIDTLYDQLEKVGGN
RELGVRAGDVRRAIGDDLGPFPAPLAMNVVPWAGSLKEDGWTSEEMKVRNESRKILGLPN
LRVSATCVRVPVVTTHSLAVHAVFDQPVDQREAQEVLAAAPGVVLVDDPAAGEFPTPADV
VGTDPTWVGRVRRSLDDPNALDLFLCGDNLRKGAALNTAQIAELVAAELTS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory