SitesBLAST
Comparing WP_012964601.1 NCBI__GCF_000025505.1:WP_012964601.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
34% identity, 97% coverage: 2:320/330 of query aligns to 1:293/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ I7), G7 (= G8), Y8 (≠ F9), G9 (= G10), N10 (≠ T11), V11 (= V12), T37 (≠ L52), R38 (≠ E53), R39 (≠ K54), V72 (≠ C86), S73 (≠ T87), S74 (≠ P88), T100 (≠ S114), K102 (= K116), G127 (≠ A141), S131 (≠ G145), E185 (= E201), G280 (= G307), A284 (≠ T311)
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
36% identity, 97% coverage: 2:320/330 of query aligns to 5:319/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G8), L12 (≠ F9), G13 (= G10), N14 (≠ T11), V15 (= V12), V45 (≠ D41), R46 (≠ S42), R47 (≠ K43), R52 (≠ G48), I63 (= I69), L78 (≠ C86), M79 (≠ T87), P84 (= P96), A102 (≠ S114), K104 (= K116), G306 (= G307), T310 (= T311)
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
35% identity, 97% coverage: 2:320/330 of query aligns to 1:295/302 of 5x9dA
- active site: D196 (= D212), K200 (= K216)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ I7), G7 (= G8), Y8 (≠ F9), G9 (= G10), N10 (≠ T11), V11 (= V12), T37 (≠ L52), R38 (≠ E53), V72 (≠ C86), S73 (≠ T87), S74 (≠ P88), P82 (= P96), T100 (≠ S114), N101 (= N115), K102 (= K116), G127 (≠ A141), S131 (≠ G145), N155 (= N170), G156 (= G171), T157 (= T172), Y183 (≠ I199), A184 (= A200), E185 (= E201), D191 (= D207), D196 (= D212), K200 (= K216), A281 (= A306), G282 (= G307), A286 (≠ T311)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
35% identity, 97% coverage: 2:322/330 of query aligns to 5:306/402 of 4pg7A
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
38% identity, 66% coverage: 104:322/330 of query aligns to 92:316/435 of Q5F8J4
Sites not aligning to the query:
- 45 L→R: Shows a marked increase in the catalytic efficiency with NADP(+).
- 45:46 LS→RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; LS→RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
33% identity, 97% coverage: 2:320/330 of query aligns to 3:309/319 of 4xb1A
- active site: D211 (= D212), K215 (= K216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ I7), F10 (= F9), G11 (= G10), T12 (= T11), V13 (= V12), D39 (= D41), R40 (≠ S42), K57 (= K59), V91 (= V91), S92 (≠ E92), S93 (= S93), S114 (= S114), K116 (= K116), S141 (≠ A141), G295 (≠ A306), T300 (= T311)
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
32% identity, 97% coverage: 2:320/330 of query aligns to 3:309/319 of 4xb2A
- active site: D211 (= D212), K215 (= K216)
- binding l-homoserine: A171 (≠ G171), S172 (≠ T172), D206 (= D207), K215 (= K216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ I7), F10 (= F9), G11 (= G10), T12 (= T11), V13 (= V12), R40 (≠ S42), V91 (= V91), S92 (≠ E92), S93 (= S93), S114 (= S114), N115 (= N115), K116 (= K116), S141 (≠ A141), G295 (≠ A306), T300 (= T311)
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
35% identity, 97% coverage: 2:320/330 of query aligns to 4:303/331 of 6a0sA
- active site: D191 (= D212), K195 (= K216)
- binding l-homoserine: K99 (= K116), N150 (= N170), G151 (= G171), T152 (= T172), Y178 (≠ I199), E180 (= E201), D186 (= D207), K195 (= K216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ F9), G12 (= G10), T13 (= T11), V14 (= V12), L42 (≠ A38), V43 (= V39), R44 (≠ A40), D45 (= D41), K48 (= K61), R50 (= R63), A73 (≠ C86), M74 (≠ T87), A97 (≠ S114), K99 (= K116), G177 (= G198), E180 (= E201), A289 (= A306), G290 (= G307), T294 (= T311)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
35% identity, 97% coverage: 2:320/330 of query aligns to 4:303/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
35% identity, 97% coverage: 2:320/330 of query aligns to 4:303/332 of 6a0tB
- active site: D191 (= D212), K195 (= K216)
- binding l-homoserine: N150 (= N170), G151 (= G171), T152 (= T172), Y178 (≠ I199), E180 (= E201), D186 (= D207), K195 (= K216)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G8), G11 (≠ F9), G12 (= G10), T13 (= T11), V14 (= V12), L42 (≠ A38), V43 (= V39), R44 (≠ A40), D45 (= D41), K48 (= K61), R50 (= R63), A73 (≠ C86), M74 (≠ T87), G75 (≠ T89), A97 (≠ S114), N98 (= N115), G177 (= G198), E180 (= E201), A289 (= A306), G290 (= G307), T294 (= T311)
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
32% identity, 97% coverage: 2:320/330 of query aligns to 4:317/321 of 3jsaA
- active site: D212 (= D212), K216 (= K216)
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), L11 (≠ F9), G12 (= G10), N13 (≠ T11), V14 (= V12), D42 (= D41), S43 (= S42), A90 (≠ C86), T91 (= T87), P92 (= P88), A117 (≠ S114), N118 (= N115), A144 (= A141), T308 (= T311)
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
30% identity, 97% coverage: 2:320/330 of query aligns to 3:314/319 of 3ingA
- active site: D209 (= D212), K213 (= K216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), T10 (≠ F9), G11 (= G10), N12 (≠ T11), V13 (= V12), D38 (= D41), S39 (= S42), K57 (= K59), C85 (= C86), T86 (= T87), P87 (= P88), A112 (≠ S114), N113 (= N115), K114 (= K116), A139 (= A141), E198 (= E201), S199 (= S202), P302 (≠ K308), T305 (= T311)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 67% coverage: 2:221/330 of query aligns to 558:781/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 45% coverage: 105:251/330 of query aligns to 112:263/376 of O94671
- S201 (≠ P186) modified: Phosphoserine
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 75% coverage: 1:249/330 of query aligns to 5:243/359 of P31116
- 11:18 (vs. 7:14, 63% identical) binding
- T93 (= T87) binding
- K117 (= K116) binding
- E208 (= E201) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D212) mutation to L: Reduces kcat 150-fold.
- K223 (= K216) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
24% identity, 75% coverage: 1:249/330 of query aligns to 4:242/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
24% identity, 75% coverage: 1:249/330 of query aligns to 4:242/358 of 1q7gA
- active site: D218 (= D212), K222 (= K216)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G10), V14 (≠ T11), V15 (= V12), E39 (≠ D41), N91 (≠ C86), T92 (= T87), S93 (≠ P88), I97 (≠ E92), P114 (≠ S114), K116 (= K116), A143 (= A141), S173 (≠ N170), K222 (= K216)
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
24% identity, 75% coverage: 1:249/330 of query aligns to 4:242/358 of 1ebuD
- active site: D218 (= D212), K222 (= K216)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G8), A12 (≠ F9), G13 (= G10), V14 (≠ T11), V15 (= V12), E39 (≠ D41), A40 (≠ S42), N91 (≠ C86), S93 (≠ P88), K116 (= K116)
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
24% identity, 75% coverage: 1:249/330 of query aligns to 4:242/358 of 1ebfA
- active site: D218 (= D212), K222 (= K216)
- binding nicotinamide-adenine-dinucleotide: I10 (= I7), A12 (≠ F9), G13 (= G10), V14 (≠ T11), V15 (= V12), E39 (≠ D41), A40 (≠ S42), T92 (= T87), S93 (≠ P88), P114 (≠ S114)
Query Sequence
>WP_012964601.1 NCBI__GCF_000025505.1:WP_012964601.1
MIKIAIIGFGTVGQGVAELLLRKRSEIEGRIGKFKVVAVADSKSSVVGEVDLEKALNEKR
KKRRLSGDITAMEIIENVEYDVLFECTPTNVESGEPGLTHIKAALKRGKNVITSNKGPLV
VAYNELCKLAEKNSCKLGFEATVGGAMPLIKLVKNDLAGSGILRIRGILNGTCNYILSRM
EVEKMPYEQILSEAIELGIAESDPSYDVKGIDAAAKLVIIANALLERNVRFEDVHIEGIE
DLTPEAFEVALKKGYTIRLIAEVGDSLRVSPRLVPLNHPLNIYGTLNAAEIVTETAGRVF
VIGRGAGKLETASAMISDLIDMYDRRNLRC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory