SitesBLAST
Comparing WP_012964912.1 NCBI__GCF_000025505.1:WP_012964912.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
65% identity, 99% coverage: 1:329/334 of query aligns to 1:328/344 of C8WR67
- YGSQ 25:28 (= YGSQ 25:28) binding
- R48 (≠ Y48) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (= S53) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DTVQ 83:86) binding
- G133 (= G134) binding
- D190 (= D191) binding
- E194 (= E195) binding
- E226 (= E227) binding
8ep7C Crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with NADP
64% identity, 98% coverage: 3:328/334 of query aligns to 2:326/328 of 8ep7C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), Q83 (≠ V85), V87 (= V89), H106 (= H108)
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
65% identity, 98% coverage: 3:329/334 of query aligns to 2:327/333 of 4tskA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding magnesium ion: D189 (= D191), D189 (= D191), E193 (= E195), E193 (= E195), R246 (≠ W248), Y247 (= Y249), I249 (≠ V251), D251 (= D253), Q254 (≠ K256)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), L46 (= L47), R47 (≠ Y48), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133)
7q03A Ketol-acid reductoisomerase from methanothermococcus thermolithotrophicus in the close state with NADP and mg2+ (see paper)
60% identity, 96% coverage: 3:324/334 of query aligns to 2:323/328 of 7q03A
- binding magnesium ion: D190 (= D191), E194 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), R47 (≠ Y48), S52 (= S53), L79 (= L80), I80 (= I81), P81 (= P82), D82 (= D83), I84 (≠ V85), H107 (= H108), P132 (= P133)
E0SRA9 Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 from Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) (see paper)
58% identity, 97% coverage: 1:325/334 of query aligns to 1:325/335 of E0SRA9
8upqB Campylobacter jejuni ketol-acid reductoisomerase in complex with 2,3- dihydroxy-3-isovalerate.
56% identity, 99% coverage: 4:334/334 of query aligns to 4:337/342 of 8upqB
8uppA Campylobacter jejuni ketol-acid reductoisomerase in complex with NADPH and hoe704
56% identity, 97% coverage: 4:328/334 of query aligns to 3:327/327 of 8uppA
- binding magnesium ion: D190 (= D191), E194 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F24 (≠ Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), R47 (≠ Y48), S50 (= S51), L79 (= L80), P81 (= P82), D82 (= D83), I84 (≠ V85), Q85 (= Q86), I88 (≠ V89), H107 (= H108), P132 (= P133), I250 (≠ V251), S251 (= S252)
- binding (2R)-(dimethylphosphoryl)(hydroxy)acetic acid: A131 (≠ S132), P132 (= P133), D190 (= D191), E194 (= E195), E230 (= E231), I250 (≠ V251), S251 (= S252), A254 (= A255)
8sxdA Campylobacter jejuni keto-acid reductoisomerase in complex with intermediate and NADP+
56% identity, 97% coverage: 4:328/334 of query aligns to 3:327/327 of 8sxdA
- binding magnesium ion: D190 (= D191), E194 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G24), F24 (≠ Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), S50 (= S51), S52 (= S53), L79 (= L80), A80 (≠ I81), P81 (= P82), D82 (= D83), P129 (= P130)
- binding 3-hydroxy-3-methyl-2-oxobutanoic acid: D190 (= D191), E194 (= E195)
7rduA Crystal structure of campylobacter jejuni keto said reductoisomerase in complex with magnesium and oxidixized and reduced NADPH
56% identity, 98% coverage: 4:329/334 of query aligns to 4:329/329 of 7rduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G24), G26 (= G26), S27 (= S27), Q28 (= Q28), R48 (≠ Y48), S51 (= S51), S53 (= S53), A81 (≠ I81), P82 (= P82), D83 (= D83), I89 (≠ V89), A107 (= A107), H108 (= H108), P130 (= P130), K131 (= K131), A132 (≠ S132)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G24 (= G24), F25 (≠ Y25), G26 (= G26), S27 (= S27), Q28 (= Q28), S51 (= S51), S53 (= S53), L80 (= L80), P82 (= P82), D83 (= D83), I89 (≠ V89), A107 (= A107), H108 (= H108)
5e4rA Crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd (see paper)
58% identity, 97% coverage: 2:325/334 of query aligns to 1:324/466 of 5e4rA
- active site: K130 (= K131), D190 (= D191), E194 (= E195)
- binding oxo(propan-2-ylamino)acetic acid: P132 (= P133), D190 (= D191), E194 (= E195)
- binding magnesium ion: D190 (= D191), E194 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G26), S26 (= S27), Q27 (= Q28), S52 (= S53), L79 (= L80), V80 (≠ I81), P81 (= P82), D82 (= D83), V84 (= V85), A106 (= A107), H107 (= H108), P132 (= P133)
Sites not aligning to the query:
C1DFH7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Azotobacter vinelandii (strain DJ / ATCC BAA-1303) (see paper)
57% identity, 98% coverage: 3:328/334 of query aligns to 2:327/338 of C1DFH7
- D190 (= D191) binding
- E226 (= E227) binding
- E230 (= E231) binding
4xiyA Crystal structure of ketol-acid reductoisomerase from azotobacter (see paper)
57% identity, 98% coverage: 3:328/334 of query aligns to 2:327/328 of 4xiyA
4xdzA Holo structure of ketol-acid reductoisomerase from ignisphaera aggregans (see paper)
58% identity, 97% coverage: 2:325/334 of query aligns to 1:324/328 of 4xdzA
- active site: K130 (= K131), D190 (= D191), E194 (= E195)
- binding oxo(propan-2-ylamino)acetic acid: P132 (= P133), D190 (= D191), E194 (= E195), L198 (= L199), E230 (= E231), V250 (= V251), S251 (= S252), A254 (= A255)
- binding magnesium ion: D190 (= D191), E194 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G24), G25 (= G26), S26 (= S27), Q27 (= Q28), E47 (≠ Y48), R48 (= R49), S52 (= S53), L79 (= L80), V80 (≠ I81), P81 (= P82), D82 (= D83), V84 (= V85), A106 (= A107), H107 (= H108), P132 (= P133)
8swmA Crystal structure of campylobacter jejuni ketol-acid reductoisomerase in complex with 2-acetolactate
56% identity, 97% coverage: 5:327/334 of query aligns to 1:323/323 of 8swmA
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
59% identity, 98% coverage: 4:329/334 of query aligns to 3:327/327 of 6bulB
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), S248 (= S250), I249 (≠ V251), S250 (= S252)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
58% identity, 97% coverage: 4:328/334 of query aligns to 3:326/326 of 6vo2A
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), I249 (≠ V251), S250 (= S252)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (≠ S132), P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I249 (≠ V251), S250 (= S252), A253 (= A255)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
58% identity, 97% coverage: 4:328/334 of query aligns to 3:326/326 of 6c5nA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), E229 (= E231), I233 (= I235), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), E229 (= E231), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), S248 (= S250), I249 (≠ V251), S250 (= S252)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
58% identity, 97% coverage: 4:328/334 of query aligns to 3:326/326 of 6c55A
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L79 (≠ I81), P80 (= P82), D81 (= D83), I83 (≠ V85), H106 (= H108), S248 (= S250), S250 (= S252)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
58% identity, 97% coverage: 4:328/334 of query aligns to 3:326/326 of 6aqjA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding oxo(propan-2-ylamino)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), I249 (≠ V251), S250 (= S252)
5w3kA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex NADPH, mg2+ and cpd (see paper)
58% identity, 97% coverage: 4:328/334 of query aligns to 3:326/326 of 5w3kA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding cyclopropane-1,1-dicarboxylic acid: D189 (= D191), E193 (= E195), E229 (= E231), I249 (≠ V251), S250 (= S252), A253 (= A255)
- binding magnesium ion: V69 (= V71), K70 (= K72), A72 (≠ S74), N100 (≠ S102), D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R49), S51 (= S53), L78 (= L80), L79 (≠ I81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), G132 (= G134), I249 (≠ V251), S250 (= S252)
Query Sequence
>WP_012964912.1 NCBI__GCF_000025505.1:WP_012964912.1
MAKIYYDKDAKLEHLKDRKVAVIGYGSQGHAHALNLRDSGVDVIVGLYRGSKSWKKAEKD
GFEVYEVSEAVKKSDFVSMLIPDTVQPAVYNKYIRDNLKEGSVLLFAHGFNIHYNQIIPP
SYVDVVLVAPKSPGHLVRRMFEEGKGVPALVAVHQDYSGKALDYALAYAKGLGCTRAGVI
ETTFKEETETDLFGEQVDLCGGVAELIKATFEILVEAGYQPEVAYFEALHELKLIVDLIY
EGGIYAMWYSVSDTAKYGGMTRGKRIINERVKEEMRKILKEIQTGEFAREWILENMAGRP
SFYKLLEMERNHPIEKVGKELRKMMPWIKGIDVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory