Comparing WP_012965238.1 NCBI__GCF_000025505.1:WP_012965238.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
59% identity, 98% coverage: 2:301/305 of query aligns to 8:312/315 of Q51742
Sites not aligning to the query:
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
51% identity, 98% coverage: 2:299/305 of query aligns to 12:309/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
51% identity, 98% coverage: 2:299/305 of query aligns to 8:305/307 of 4nf2A
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
47% identity, 98% coverage: 1:300/305 of query aligns to 1:303/304 of 8qeuA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
45% identity, 98% coverage: 1:300/305 of query aligns to 1:296/297 of 8qevA
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
46% identity, 98% coverage: 1:299/305 of query aligns to 2:304/307 of 2i6uA
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 98% coverage: 1:299/305 of query aligns to 2:304/307 of P9WIT9
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7nouA
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7nnyA
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7nnwA
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:305/308 of 7nnvA
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
46% identity, 98% coverage: 1:299/305 of query aligns to 3:302/305 of 7np0A
4a8hA Crystal structure of putrescine transcarbamylase from enterococcus faecalis with n-(phosphonoacetyl)-putrescine (see paper)
46% identity, 94% coverage: 12:299/305 of query aligns to 13:309/340 of 4a8hA
Q837U7 Putrescine carbamoyltransferase; PTC; PTCase; Agmatine catabolism protein B; Putrescine transcarbamoylase; Putrescine transcarbamylase; EC 2.1.3.6 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
46% identity, 94% coverage: 12:299/305 of query aligns to 13:309/339 of Q837U7
4am8D Crystal structure of the r54g mutant of putrescine transcarbamylase from enterococcus faecalis bound to a curing guanidinium ion
46% identity, 94% coverage: 12:299/305 of query aligns to 13:309/349 of 4am8D
4am8A Crystal structure of the r54g mutant of putrescine transcarbamylase from enterococcus faecalis bound to a curing guanidinium ion
46% identity, 94% coverage: 12:299/305 of query aligns to 13:309/336 of 4am8A
Sites not aligning to the query:
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
45% identity, 98% coverage: 1:299/305 of query aligns to 3:299/302 of 7novA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
41% identity, 98% coverage: 2:299/305 of query aligns to 40:342/354 of P00481
Sites not aligning to the query:
>WP_012965238.1 NCBI__GCF_000025505.1:WP_012965238.1
MKHVLSITDLKKEEIIEILDLADKLKEERRKGILKEYLKNKTLGMIFELPSTRTRVSFEV
AMNDCGGYAIYMNWNDLQLGRGETIADTARTLSRYVHAVMMRVRRHETLVEFAKFSSVPV
INGLSNLEHPCQILADLQTIREKKGSLNVKVAWVGDGNNVCNSLLLASAIIGFEMKLAIP
EGFDPPDEILKKAEELGGRFEILRDPKEAVRGADVIYTDVWASMGQEEERERRLKIFRPY
QVNMELVGEAKEDVIVMHCLPAHRGEEITDEVIDSEYSVVFDQAENRLHAQKALLLKLIG
GSDVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory