SitesBLAST
Comparing WP_012966230.1 NCBI__GCF_000025505.1:WP_012966230.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
43% identity, 88% coverage: 5:207/231 of query aligns to 1:207/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D106), I105 (≠ V107), H106 (= H108), I108 (= I110), G109 (= G111), V113 (= V115), S150 (≠ L152), S151 (= S153), L153 (≠ M155), M154 (= M156), T155 (= T157), M180 (≠ L180), G182 (= G182), G183 (= G183), G200 (≠ A200), S202 (≠ D202), A203 (= A203)
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
39% identity, 81% coverage: 7:194/231 of query aligns to 2:188/212 of 3ezxA
- active site: D100 (= D106), H102 (= H108), S155 (≠ T159)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M52), F54 (= F59), D100 (= D106), I101 (≠ V107), H102 (= H108), D103 (= D109), I104 (= I110), V109 (= V115), V147 (vs. gap), S149 (= S153), L151 (≠ M155), M152 (= M156), T153 (= T157), M178 (≠ L180), G180 (= G182), G181 (= G183)
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
34% identity, 91% coverage: 7:216/231 of query aligns to 36:244/258 of 2i2xB
- active site: D134 (= D106), H136 (= H108), T187 (= T159)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G105), D134 (= D106), V135 (= V107), H136 (= H108), D137 (= D109), I138 (= I110), G139 (= G111), V143 (= V115), T179 (≠ A151), T181 (≠ S153), L183 (≠ M155), M184 (= M156), T185 (= T157), A208 (≠ L180), G210 (= G182), G211 (= G183), G212 (≠ A184), G228 (≠ A200), E229 (≠ P201), E230 (≠ D202), A231 (= A203)
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
34% identity, 91% coverage: 7:216/231 of query aligns to 36:244/258 of Q46EH4
- H129 (≠ G101) mutation to K: Does not affect cobalamin-binding.
- H136 (= H108) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
33% identity, 74% coverage: 39:208/231 of query aligns to 33:199/206 of 4jgiB
- active site: D95 (= D106), H97 (= H108), A148 (≠ T159)
- binding co-methylcobalamin: L63 (≠ V69), D95 (= D106), L96 (≠ V107), H97 (= H108), D98 (= D109), I99 (= I110), G100 (= G111), F104 (≠ V115), G140 (≠ A151), S142 (= S153), L145 (≠ M156), G173 (= G182), G174 (= G183), V175 (≠ A184), S191 (≠ A200), T192 (≠ P201), N193 (≠ D202), A194 (= A203)
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
35% identity, 79% coverage: 10:192/231 of query aligns to 2:181/507 of 8sseA
Sites not aligning to the query:
- binding cobalamin: 405, 409, 451, 452, 453, 454, 463, 485, 488, 490, 492
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
48% identity, 49% coverage: 96:208/231 of query aligns to 5:119/125 of 1y80A
- active site: D15 (= D106), H17 (= H108), T68 (= T159)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D106), L16 (≠ V107), H17 (= H108), D18 (= D109), I19 (= I110), G20 (= G111), V24 (= V115), G60 (≠ A151), M61 (≠ L152), S62 (= S153), L64 (≠ M155), L65 (≠ M156), T66 (= T157), I91 (≠ L180), G93 (= G182), G94 (= G183), A95 (= A184), P112 (= P201), D113 (= D202), A114 (= A203)
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
33% identity, 78% coverage: 8:188/231 of query aligns to 11:189/576 of 3ivaA
- active site: D107 (= D106), H109 (= H108), S160 (≠ T159)
- binding cobalamin: H109 (= H108), G112 (= G111), V116 (= V115), G152 (≠ A151), L153 (= L152), S154 (= S153), L156 (≠ M155), I157 (≠ M156), T158 (= T157), G183 (= G182), G184 (= G183)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 303, 443, 486, 488, 489, 495, 520, 521, 524, 527, 528
- binding s-adenosyl-l-homocysteine: 447, 484, 485, 489, 491, 539
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
33% identity, 78% coverage: 8:188/231 of query aligns to 11:189/577 of 3bulA
- active site: D107 (= D106), H109 (= H108), S160 (≠ T159)
- binding cobalamin: H109 (= H108), V116 (= V115), G152 (≠ A151), L153 (= L152), S154 (= S153), L156 (≠ M155), I157 (≠ M156), T158 (= T157), G183 (= G182), G184 (= G183)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 210, 213, 302, 443, 486, 487, 488, 489, 495, 498, 521, 524, 527, 528
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
33% identity, 78% coverage: 8:188/231 of query aligns to 11:189/246 of 1bmtA
- active site: D107 (= D106), H109 (= H108), S160 (≠ T159)
- binding co-methylcobalamin: E44 (≠ M45), M48 (≠ V49), M51 (= M52), G55 (= G56), L65 (≠ V66), V68 (= V69), D107 (= D106), V108 (= V107), H109 (= H108), D110 (= D109), I111 (= I110), I115 (≠ L114), G152 (≠ A151), L153 (= L152), S154 (= S153), L156 (≠ M155), I157 (≠ M156), T158 (= T157), G183 (= G182), G184 (= G183), A185 (= A184)
Sites not aligning to the query:
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 78% coverage: 8:188/231 of query aligns to 661:839/1227 of P13009
- E694 (≠ M45) binding
- GDVHD 756:760 (= GDVHD 105:109) binding
- D757 (= D106) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H108) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S153) binding
- T808 (= T157) binding
- S810 (≠ T159) mutation to A: Decreases activity by about 40%.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 860 binding
- 946 binding
- 1134 binding
- 1189:1190 binding
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
30% identity, 83% coverage: 2:193/231 of query aligns to 627:808/841 of 8g3hA
- binding cobalamin: F675 (= F59), V685 (= V69), K693 (≠ Y77), G720 (= G105), V722 (= V107), H723 (= H108), D724 (= D109), I725 (= I110), G726 (= G111), V730 (= V115), M767 (≠ L152), S768 (= S153), L770 (≠ M155), V772 (≠ T157), I795 (≠ L180), L796 (≠ V181), G797 (= G182), G798 (= G183), A799 (= A184)
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
31% identity, 89% coverage: 2:207/231 of query aligns to 663:890/1265 of Q99707
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
- 382:384 binding
- 449 binding
- 470 binding
- 537 binding
- 579 binding
- 585 binding
- 591 binding
- 919 D → G: in dbSNP:rs1805087
- 963 D→E: Decreases binding to MTRR; when associated with N-1071.
- 1071 K→N: Decreases binding to MTRR; when associated with E-963.
1i9cA Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate (see paper)
31% identity, 27% coverage: 95:156/231 of query aligns to 3:64/137 of 1i9cA
- active site: V10 (= V102), D14 (= D106), H16 (= H108)
- binding cobalamin: S13 (≠ G105), D14 (= D106), C15 (≠ V107), H16 (= H108), A17 (≠ D109), G19 (= G111), L23 (≠ V115), S61 (= S153), L63 (≠ M155), Y64 (≠ M156)
Sites not aligning to the query:
8j2xA Saccharothrix syringae photocobilins protein, light state (see paper)
28% identity, 49% coverage: 94:206/231 of query aligns to 89:201/337 of 8j2xA
- binding cobalamin: W102 (≠ V107), H103 (= H108), A104 (≠ D109), L105 (≠ I110), P106 (≠ G111), V110 (= V115), A146 (= A151), L147 (= L152), S148 (= S153), L151 (≠ M156), L173 (= L180), V174 (= V181), G175 (= G182), G176 (= G183), A195 (= A200), P196 (= P201), T197 (≠ D202), A198 (= A203)
Sites not aligning to the query:
- binding cobalamin: 46, 49, 53, 56, 57, 287
- binding biliverdine ix alpha: 56, 250, 253, 254, 257, 258, 261, 264, 287, 292, 295, 297, 301
5c8dE Crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) (see paper)
25% identity, 91% coverage: 10:220/231 of query aligns to 84:280/280 of 5c8dE
- binding cobalamin: L118 (≠ V49), R122 (≠ E53), G125 (= G56), E138 (≠ V69), S142 (≠ A73), G171 (= G105), R173 (≠ V107), H174 (= H108), E175 (≠ D109), G177 (= G111), S219 (= S153), L222 (≠ M156), G244 (= G182), G245 (= G183), M261 (≠ W199), D263 (≠ A203), L264 (≠ T204)
1ccwA Structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium (see paper)
31% identity, 27% coverage: 95:156/231 of query aligns to 3:64/137 of 1ccwA
- active site: V10 (= V102), D14 (= D106), H16 (= H108)
- binding cyanocobalamin: D14 (= D106), C15 (≠ V107), H16 (= H108), A17 (≠ D109), G19 (= G111), I22 (≠ L114), S61 (= S153), L63 (≠ M155), Y64 (≠ M156)
Sites not aligning to the query:
1cb7A Glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin (see paper)
31% identity, 27% coverage: 95:156/231 of query aligns to 3:64/137 of 1cb7A
- active site: V10 (= V102), D14 (= D106), H16 (= H108)
- binding co-methylcobalamin: D14 (= D106), C15 (≠ V107), H16 (= H108), A17 (≠ D109), G19 (= G111), L23 (≠ V115), S61 (= S153), L63 (≠ M155), Y64 (≠ M156)
Sites not aligning to the query:
5c8eA Crystal structure of thermus thermophilus carh bound to adenosylcobalamin and a 26-bp DNA segment (see paper)
25% identity, 81% coverage: 10:197/231 of query aligns to 83:258/273 of 5c8eA
- binding cobalamin: L117 (≠ V49), L120 (≠ M52), G124 (= G56), E137 (≠ V69), G170 (= G105), R172 (≠ V107), H173 (= H108), E174 (≠ D109), G176 (= G111), S218 (= S153), L221 (≠ M156), G243 (= G182), G244 (= G183)
Sites not aligning to the query:
- binding cobalamin: 260, 263
- binding : 20, 25, 26, 33, 36, 37, 38, 38, 39, 62
1id8A Nmr structure of glutamate mutase (b12-binding subunit) complexed with the vitamin b12 nucleotide (see paper)
29% identity, 27% coverage: 95:156/231 of query aligns to 3:64/137 of 1id8A
Sites not aligning to the query:
Query Sequence
>WP_012966230.1 NCBI__GCF_000025505.1:WP_012966230.1
MVDEAKRKEILEKLKRGVVEFDEDLVREAAKEALEVGMDALDAIMNGLVAGMEEVGELFD
KGEYFVPEVLMCADALYAGLEILRPHVKKEDIKVKGQVVIGVVEGDVHDIGKNLVKMMFE
VAGFEVIDLGKDVPLEKFVEESLKSDADIVALSAMMTTTMLGIPKVIQMIREKNPKAKIL
VGGAPISKETAEKWGADGWAPDATNAVQEAINMIKGLKKEIMGEEKGEEKN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory