Comparing WP_012966597.1 NCBI__GCF_000025505.1:WP_012966597.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1hg3A Crystal structure of tetrameric tim from pyrococcus woesei. (see paper)
56% identity, 99% coverage: 1:219/222 of query aligns to 3:221/224 of 1hg3A
P62003 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Pyrococcus woesei (see 2 papers)
56% identity, 99% coverage: 1:219/222 of query aligns to 4:222/228 of P62003
Sites not aligning to the query:
1w0mA Triosephosphate isomerase from thermoproteus tenax (see paper)
50% identity, 98% coverage: 1:218/222 of query aligns to 1:218/225 of 1w0mA
Q8NKN9 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1) (see paper)
50% identity, 98% coverage: 1:218/222 of query aligns to 1:218/226 of Q8NKN9
5csrC Crystal structure of triosephosphate isomerase from thermoplasma acidophilium (see paper)
40% identity, 97% coverage: 7:222/222 of query aligns to 5:216/220 of 5csrC
5cssA Crystal structure of triosephosphate isomerase from thermoplasma acidophilum with glycerol 3-phosphate (see paper)
40% identity, 96% coverage: 7:219/222 of query aligns to 5:213/214 of 5cssA
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
30% identity, 67% coverage: 61:208/222 of query aligns to 63:239/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
30% identity, 67% coverage: 61:208/222 of query aligns to 63:239/255 of B1XB85
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
32% identity, 57% coverage: 41:166/222 of query aligns to 40:194/256 of P50921
Sites not aligning to the query:
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
32% identity, 57% coverage: 41:166/222 of query aligns to 39:193/255 of 1aw1A
Sites not aligning to the query:
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
28% identity, 78% coverage: 35:207/222 of query aligns to 38:241/252 of 6oogA
Sites not aligning to the query:
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
26% identity, 75% coverage: 41:207/222 of query aligns to 45:244/255 of 6ooiC
Sites not aligning to the query:
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
28% identity, 67% coverage: 1:149/222 of query aligns to 1:175/253 of P00943
Sites not aligning to the query:
4y90A Crystal structure of triosephosphate isomerase from deinococcus radiodurans (see paper)
36% identity, 34% coverage: 46:120/222 of query aligns to 44:124/244 of 4y90A
Sites not aligning to the query:
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
31% identity, 54% coverage: 1:120/222 of query aligns to 1:126/253 of P27876
Sites not aligning to the query:
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
30% identity, 47% coverage: 45:149/222 of query aligns to 45:174/251 of 1btmA
Sites not aligning to the query:
1ssgA Understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase (see paper)
25% identity, 69% coverage: 30:183/222 of query aligns to 31:212/247 of 1ssgA
Sites not aligning to the query:
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
24% identity, 77% coverage: 39:208/222 of query aligns to 40:239/250 of 4y96A
Sites not aligning to the query:
P00940 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Gallus gallus (Chicken) (see 3 papers)
25% identity, 69% coverage: 30:183/222 of query aligns to 32:213/248 of P00940
Sites not aligning to the query:
>WP_012966597.1 NCBI__GCF_000025505.1:WP_012966597.1
MEKKVVIINFKAYREGAGKNALELAKAVEKVAEKSDFYFGVAPNFLDLAEIVKSVGIDVY
AQHVDAVEFGSHTGRITAEMIKEKGAKGSLINHSERRLRLADIDFLVSKFKELGLISVVC
TNNVSTTAAAAALSPDFVAVEPPELIGSGIPVSKAEPEVVENSVRAAKNVNEEVKVLCGA
GITKYEDVVAAIDLGADGVLLASGVVKASDPRKALEELVGLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory