Comparing WP_012968296.1 NCBI__GCF_000025465.1:WP_012968296.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
31% identity, 96% coverage: 1:202/210 of query aligns to 1:200/207 of 4ij6A
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
30% identity, 96% coverage: 1:202/210 of query aligns to 1:196/196 of 6m1xC
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
30% identity, 97% coverage: 1:203/210 of query aligns to 1:197/198 of 5zr2C
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
28% identity, 79% coverage: 6:171/210 of query aligns to 6:169/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
28% identity, 79% coverage: 6:171/210 of query aligns to 6:169/207 of 1h2eA
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 90% coverage: 4:193/210 of query aligns to 10:205/211 of P36623
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
31% identity, 64% coverage: 4:138/210 of query aligns to 6:139/257 of Q7ZVE3
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
23% identity, 89% coverage: 1:186/210 of query aligns to 1:216/247 of P00950
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
26% identity, 72% coverage: 3:153/210 of query aligns to 3:158/209 of 4qihA
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
23% identity, 88% coverage: 3:186/210 of query aligns to 2:215/240 of 1qhfA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
26% identity, 72% coverage: 3:153/210 of query aligns to 5:160/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
26% identity, 72% coverage: 3:153/210 of query aligns to 4:159/217 of 4pzaB
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
23% identity, 88% coverage: 3:186/210 of query aligns to 2:215/234 of 5pgmE
Sites not aligning to the query:
1bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate (see paper)
31% identity, 75% coverage: 4:161/210 of query aligns to 215:363/432 of 1bifA
Sites not aligning to the query:
3lg2A A ykr043c/ fructose-1,6-bisphosphate product complex following ligand soaking (see paper)
31% identity, 47% coverage: 5:102/210 of query aligns to 7:115/269 of 3lg2A
Sites not aligning to the query:
P36136 Sedoheptulose 1,7-bisphosphatase; EC 3.1.3.37 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 47% coverage: 5:102/210 of query aligns to 9:117/271 of P36136
Sites not aligning to the query:
P16118 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see paper)
28% identity, 80% coverage: 4:171/210 of query aligns to 254:412/471 of P16118
Sites not aligning to the query:
5y65C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh2
22% identity, 77% coverage: 3:164/210 of query aligns to 3:196/239 of 5y65C
8it4A Phosphoglycerate mutase 1 complexed with a covalent inhibitor
22% identity, 77% coverage: 3:164/210 of query aligns to 3:196/233 of 8it4A
5y2iB Phosphoglycerate mutase 1 (pgam1) complexed with its inhibitor pgmi- 004a
22% identity, 77% coverage: 3:164/210 of query aligns to 3:196/233 of 5y2iB
>WP_012968296.1 NCBI__GCF_000025465.1:WP_012968296.1
MMQVILVRHAETEWNIKGIIQGQSDSALTPRGERQTSALLAAFAASDYRVDCVYTSPLGR
AWQMGQRLAGHFRCPLIAEPALKEQAFGQFEGMLTSQLMQQRPHDAHALFTHDAEYCPPQ
GESLAQATRRVTGFIHNLPEATEHQRICIVTHGQVSQGVLAVLKEGTIDNFSRYAHPNAS
YSVFDFRDGKCLAIRWGIATHLLQLERQNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory