SitesBLAST
Comparing WP_012970853.1 NCBI__GCF_000025485.1:WP_012970853.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
58% identity, 89% coverage: 53:487/488 of query aligns to 5:435/440 of 3slhD
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N95 (= N142), R125 (= R172), D317 (= D365), E345 (= E393), H388 (= H440), R389 (= R441), T415 (= T467)
- binding glyphosate: K23 (= K71), G97 (= G144), T98 (= T145), R125 (= R172), Q171 (= Q219), D317 (= D365), E345 (= E393), R348 (= R396), H388 (= H440), R389 (= R441)
- binding shikimate-3-phosphate: S24 (= S72), R28 (= R76), S169 (= S217), Q171 (= Q219), R196 (= R244), D317 (= D365), K344 (= K392)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S72), R28 (= R76), T98 (= T145), Q171 (= Q219), R196 (= R244), D317 (= D365), K344 (= K392)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
58% identity, 89% coverage: 53:487/488 of query aligns to 3:433/438 of Q83E11
- KS 21:22 (= KS 71:72) binding
- R26 (= R76) binding
- NSGT 93:96 (= NSGT 142:145) Phosphoenolpyruvate
- R123 (= R172) binding
- D315 (= D365) active site, Proton acceptor
- K342 (= K392) binding
- R346 (= R396) binding
- R387 (= R441) binding
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
58% identity, 89% coverage: 53:487/488 of query aligns to 5:431/434 of 4egrA
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N95 (= N142), R125 (= R172), D313 (= D365), E341 (= E393), H384 (= H440), R385 (= R441), T411 (= T467)
- binding phosphoenolpyruvate: K23 (= K71), G97 (= G144), T98 (= T145), R125 (= R172), D313 (= D365), E341 (= E393), R344 (= R396), R385 (= R441)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
47% identity, 84% coverage: 61:472/488 of query aligns to 10:417/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
47% identity, 84% coverage: 61:472/488 of query aligns to 10:417/427 of 1rf6A
- active site: K20 (= K71), S21 (= S72), D47 (= D98), N90 (= N142), D115 (= D167), R120 (= R172), D312 (= D365), E340 (= E393), H384 (= H440), R385 (= R441), T412 (= T467)
- binding glyphosate: K20 (= K71), G92 (= G144), T93 (= T145), R120 (= R172), Q168 (= Q219), D312 (= D365), E340 (= E393), R343 (= R396), H384 (= H440), R385 (= R441)
- binding shikimate-3-phosphate: S21 (= S72), R25 (= R76), S166 (= S217), Q168 (= Q219), R193 (= R244), I311 (= I364), D312 (= D365), K339 (= K392)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
47% identity, 84% coverage: 61:472/488 of query aligns to 10:417/427 of 1rf4A
- active site: K20 (= K71), S21 (= S72), D47 (= D98), N90 (= N142), D115 (= D167), R120 (= R172), D312 (= D365), E340 (= E393), H384 (= H440), R385 (= R441), T412 (= T467)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K71), S21 (= S72), R25 (= R76), G92 (= G144), T93 (= T145), R120 (= R172), S166 (= S217), A167 (= A218), Q168 (= Q219), R193 (= R244), D312 (= D365), K339 (= K392), E340 (= E393), R343 (= R396), H384 (= H440), R385 (= R441)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
46% identity, 87% coverage: 61:484/488 of query aligns to 13:443/445 of 2pqcA
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N93 (= N142), R123 (= R172), D321 (= D365), E349 (= E393), H399 (= H440), R400 (= R441), T426 (= T467)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K71), S24 (= S72), R28 (= R76), T96 (= T145), R123 (= R172), S168 (= S217), Q170 (= Q219), D321 (= D365), K348 (= K392), E349 (= E393), R352 (= R396), R400 (= R441)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
46% identity, 87% coverage: 61:484/488 of query aligns to 13:443/445 of 2pqbA
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N93 (= N142), R123 (= R172), D321 (= D365), E349 (= E393), H399 (= H440), R400 (= R441), T426 (= T467)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K71), S24 (= S72), R28 (= R76), A95 (≠ G144), T96 (= T145), R123 (= R172), S168 (= S217), Q170 (= Q219), D321 (= D365), K348 (= K392), E349 (= E393), R352 (= R396), R400 (= R441)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
46% identity, 87% coverage: 61:484/488 of query aligns to 13:443/445 of 2ggaA
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N93 (= N142), R123 (= R172), D321 (= D365), E349 (= E393), H399 (= H440), R400 (= R441), T426 (= T467)
- binding glyphosate: K23 (= K71), A94 (≠ S143), A95 (≠ G144), T96 (= T145), R123 (= R172), D321 (= D365), E349 (= E393), R352 (= R396), R400 (= R441)
- binding shikimate-3-phosphate: S24 (= S72), R28 (= R76), S168 (= S217), A169 (= A218), Q170 (= Q219), R195 (= R244), D321 (= D365), K348 (= K392)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
46% identity, 87% coverage: 61:484/488 of query aligns to 13:443/445 of 2gg6A
- active site: K23 (= K71), S24 (= S72), D50 (= D98), N93 (= N142), R123 (= R172), D321 (= D365), E349 (= E393), H399 (= H440), R400 (= R441), T426 (= T467)
- binding shikimate-3-phosphate: S24 (= S72), R28 (= R76), T96 (= T145), S168 (= S217), Q170 (= Q219), D321 (= D365), K348 (= K392)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
46% identity, 87% coverage: 61:484/488 of query aligns to 18:448/455 of Q9R4E4
- KS 28:29 (= KS 71:72) binding
- R33 (= R76) binding
- NAAT 98:101 (≠ NSGT 142:145) Phosphoenolpyruvate
- A100 (≠ G144) mutation to G: Confers resistance to glyphosate.
- R128 (= R172) binding
- K353 (= K392) binding
- R357 (= R396) binding
- R405 (= R441) binding
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
29% identity, 86% coverage: 54:472/488 of query aligns to 78:506/516 of P11043
- G173 (= G144) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
27% identity, 86% coverage: 55:472/488 of query aligns to 6:417/426 of 3nvsA
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), H128 (≠ R176), Q135 (≠ L183), Y142 (≠ T190), E144 (≠ S191), A247 (= A287), A255 (≠ S295), D314 (≠ L362), E342 (= E393), H386 (= H440), R387 (= R441), K412 (≠ T467)
- binding glyphosate: K22 (= K71), G96 (= G144), R124 (= R172), Q172 (= Q219), D314 (≠ L362), E342 (= E393), R345 (= R396), H386 (= H440), R387 (= R441)
- binding magnesium ion: E123 (≠ R171), Q145 (≠ P192)
- binding shikimate-3-phosphate: K22 (= K71), S23 (= S72), R27 (= R76), T97 (= T145), S170 (= S217), S171 (≠ A218), Q172 (= Q219), S198 (≠ P240), Y201 (≠ T243), D314 (≠ L362), N337 (≠ E388), K341 (= K392)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S72), R27 (= R76), Q172 (= Q219), Y201 (≠ T243), D314 (≠ L362), K341 (= K392)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
27% identity, 86% coverage: 55:472/488 of query aligns to 6:417/426 of Q9KRB0
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 2pq9A
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K71), S23 (= S72), R27 (= R76), G96 (= G144), T97 (= T145), R124 (= R172), S169 (≠ A216), S170 (= S217), Q171 (≠ A218), S197 (≠ P240), Y200 (≠ T243), D313 (= D365), N336 (≠ E388), K340 (= K392), R344 (= R396), H385 (= H440), R386 (= R441), K411 (≠ T467)
2aa9A Epsp synthase liganded with shikimate (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 2aa9A
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K71), S23 (= S72), R27 (= R76), T97 (= T145), Q171 (≠ A218), Y200 (≠ T243), D313 (= D365), K340 (= K392)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 1x8tA
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K71), S23 (= S72), R27 (= R76), T97 (= T145), S169 (≠ A216), S170 (= S217), Q171 (≠ A218), S197 (≠ P240), Y200 (≠ T243), D313 (= D365), N336 (≠ E388), K340 (= K392), R344 (= R396), H385 (= H440), R386 (= R441)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 1x8rA
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K71), S23 (= S72), R27 (= R76), G96 (= G144), T97 (= T145), R124 (= R172), S169 (≠ A216), S170 (= S217), Q171 (≠ A218), S197 (≠ P240), Y200 (≠ T243), D313 (= D365), N336 (≠ E388), K340 (= K392), E341 (= E393), H385 (= H440), K411 (≠ T467)
1g6tA Structure of epsp synthase liganded with shikimate-3-phosphate (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 1g6tA
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding phosphate ion: K22 (= K71), G96 (= G144), T97 (= T145), R124 (= R172), Q171 (≠ A218), E341 (= E393), K411 (≠ T467)
- binding shikimate-3-phosphate: K22 (= K71), S23 (= S72), R27 (= R76), T97 (= T145), S169 (≠ A216), S170 (= S217), Q171 (≠ A218), S197 (≠ P240), Y200 (≠ T243), D313 (= D365), N336 (≠ E388), K340 (= K392)
1g6sA Structure of epsp synthase liganded with shikimate-3-phosphate and glyphosate (see paper)
28% identity, 86% coverage: 55:476/488 of query aligns to 6:421/427 of 1g6sA
- active site: K22 (= K71), S23 (= S72), D49 (= D98), N94 (= N142), P119 (≠ D167), R124 (= R172), D313 (= D365), E341 (= E393), H385 (= H440), R386 (= R441), K411 (≠ T467)
- binding glyphosate: K22 (= K71), G96 (= G144), R124 (= R172), Q171 (≠ A218), D313 (= D365), E341 (= E393), R344 (= R396), H385 (= H440), R386 (= R441)
- binding shikimate-3-phosphate: K22 (= K71), S23 (= S72), R27 (= R76), T97 (= T145), S169 (≠ A216), S170 (= S217), Q171 (≠ A218), S197 (≠ P240), Y200 (≠ T243), D313 (= D365), N336 (≠ E388), K340 (= K392)
Query Sequence
>WP_012970853.1 NCBI__GCF_000025485.1:WP_012970853.1
MMLERVGPTSYLNFHPSVVCVGSPPGDCYNPSPFITGHASLGDALSSLIDHRYLISPGGS
LRGRLRVPGDKSISHRSIMLSAIAEGRTQVSGFLEGADALATLAAFRAMGVSIEGPSDGE
LVIEGVGMRGLRAPDTTLDMGNSGTAMRLLVGLLAGQGFTATLVGDDSLTRRPMRRVTEP
LALMGAQIRTSPTGTAPLTIEPVDHLNGLEYRLPMASAQVKSCLMLAGLYAEGETCIVEP
EPTRDHTERMLTAFGYSVRRQGLRVCLTGGGRLTACRLRIPADISSAAFFLVGASIAPGS
DLLLEAVGINPTRVGVINIMRAMGADIELLDKRTAGGEPVADIRVKSARLRGIRIPVDQV
PLAIDEFPALFIAAACAEGETVLTGAEELRVKESDRIQVMADGLTKLGIQAEPTPDGIRI
QGGTLGSATGENAIEAHGDHRIAMSFAIAGLRASGPIEVRDCANVETSFPGFPQLASNAG
LTIEEQRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory