Comparing WP_012972003.1 NCBI__GCF_000025485.1:WP_012972003.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
51% identity, 97% coverage: 6:382/390 of query aligns to 3:378/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 83% coverage: 60:382/390 of query aligns to 53:382/383 of 7uoiA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 94% coverage: 11:378/390 of query aligns to 1:362/366 of Q8P8J5
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 93% coverage: 19:381/390 of query aligns to 13:374/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 93% coverage: 19:381/390 of query aligns to 13:374/376 of 4o23A
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 94% coverage: 11:378/390 of query aligns to 2:357/360 of 2f7vA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 93% coverage: 23:384/390 of query aligns to 17:377/377 of 7t1qA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
27% identity, 72% coverage: 69:349/390 of query aligns to 67:364/408 of Q03154
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 91% coverage: 26:378/390 of query aligns to 16:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 91% coverage: 26:378/390 of query aligns to 20:375/380 of 5vo3A
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
29% identity, 59% coverage: 55:286/390 of query aligns to 55:297/407 of P37111
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
24% identity, 83% coverage: 38:360/390 of query aligns to 30:354/377 of 7lgpB
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
31% identity, 55% coverage: 60:273/390 of query aligns to 82:302/426 of 3pfoA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
27% identity, 38% coverage: 26:174/390 of query aligns to 18:170/258 of 4h2kA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
27% identity, 80% coverage: 63:375/390 of query aligns to 45:331/341 of 5xoyA
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
22% identity, 83% coverage: 58:380/390 of query aligns to 51:373/373 of 3rzaA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 35% coverage: 4:138/390 of query aligns to 17:160/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
40% identity, 19% coverage: 64:138/390 of query aligns to 114:191/507 of Q96KN2
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
33% identity, 22% coverage: 69:154/390 of query aligns to 61:151/192 of 1q7lA
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
30% identity, 37% coverage: 63:206/390 of query aligns to 4:151/392 of 7m6uB
Sites not aligning to the query:
>WP_012972003.1 NCBI__GCF_000025485.1:WP_012972003.1
MTTQSPSLKTMLEGLIGTLSVSSVTPAFDHSNEPLVTLLADWLESAGFRAEILPVPGHPG
KFNLLGTLGSGPGGLVLSGHTDTVPFDAPLWTHDPLKLTEADGRYYGLGTSDMKSFFALA
LEAARAFRASDLKCPLMILATADEESAMHGARALVTAGRPLGRHALIGEPTNLRPVRLHK
GVMGESVRLVGRSGHASDPSLGNNALDGMHEVMSVILDWRAELQQAHRHPAFPVPYPTVN
LGHIHGGDNPNRICGECELHLDLRVLPGMDPADLRNALAERVAGVGRRRGLQWSVEPLFA
PIPPAETPTTAAIVRACESLTGHAAEAVSFGTEMPFLNQLGMDTLILGPGDIAQAHQPDE
FLALDRIPPTLELLRALIRRFCVEGEAAAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory