Comparing WP_012972230.1 NCBI__GCF_000025485.1:WP_012972230.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
52% identity, 97% coverage: 3:274/281 of query aligns to 2:271/271 of 1nytA
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
52% identity, 97% coverage: 3:274/281 of query aligns to 2:271/272 of P15770
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
50% identity, 96% coverage: 3:271/281 of query aligns to 6:272/278 of Q9KVT3
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
50% identity, 96% coverage: 3:271/281 of query aligns to 2:268/272 of 3pgjA
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
49% identity, 96% coverage: 3:271/281 of query aligns to 2:264/268 of 3sefA
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
46% identity, 96% coverage: 3:271/281 of query aligns to 2:269/272 of P43876
3sefC 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
46% identity, 96% coverage: 3:271/281 of query aligns to 2:241/244 of 3sefC
1p77A Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae (see paper)
46% identity, 96% coverage: 3:271/281 of query aligns to 2:262/265 of 1p77A
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
34% identity, 91% coverage: 2:257/281 of query aligns to 6:252/267 of 2hk9B
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
34% identity, 91% coverage: 2:257/281 of query aligns to 6:252/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
34% identity, 91% coverage: 2:257/281 of query aligns to 6:252/269 of O67049
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
32% identity, 91% coverage: 5:261/281 of query aligns to 3:253/269 of Q5HNV1
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
31% identity, 91% coverage: 5:261/281 of query aligns to 3:244/258 of 3dooA
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 90% coverage: 7:260/281 of query aligns to 11:267/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
32% identity, 90% coverage: 7:260/281 of query aligns to 16:272/287 of 1nvtB
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
32% identity, 90% coverage: 7:260/281 of query aligns to 16:272/287 of 1nvtA
P56119 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
35% identity, 88% coverage: 5:252/281 of query aligns to 6:242/263 of P56119
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
33% identity, 91% coverage: 2:258/281 of query aligns to 234:478/501 of 2o7qA
Sites not aligning to the query:
3phiA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with shikimate and NADPH
34% identity, 88% coverage: 5:252/281 of query aligns to 6:239/259 of 3phiA
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
33% identity, 91% coverage: 2:258/281 of query aligns to 234:477/500 of 2o7sA
Sites not aligning to the query:
>WP_012972230.1 NCBI__GCF_000025485.1:WP_012972230.1
MTDHYAVIGHPIAHSKSPVIHAAFARQTGQDLEYGRLLGALDDFAGDVRRFLESGGLGLN
VTVPFKEQAWALADERSARAELAGAVNTLIRLDDGRLRGENTDGVGLVRDLTDNHGFDFA
GARVLMLGAGGAARGVLQPLLGTGLARLVIANRTASKALELARLGRALGPVEGCGFDGLA
GERFDLIIHATSAGLADAVPAIPDDCLAPDGWTYDMLYGDRPTPFCRWGSEHGAARVLDG
LGMLIEQAAESFWLWRGVRPETGPVIASLRRPASLSSPPPT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory