SitesBLAST
Comparing WP_012974023.1 NCBI__GCF_000010725.1:WP_012974023.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
48% identity, 98% coverage: 6:351/353 of query aligns to 6:355/362 of 3bptA
- active site: G67 (= G67), P84 (= P88), R88 (≠ S94), G115 (= G121), G118 (= G124), E138 (= E144), D146 (= D152)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G66), G67 (= G67), I69 (≠ V69), E90 (= E96), G114 (= G120), G115 (= G121), E138 (= E144), D146 (= D152), V147 (= V153)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ A25), L26 (= L26), A28 (= A28), G66 (= G66), G67 (= G67), I69 (≠ V69), P137 (= P143), I141 (= I147), L319 (= L315)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 97% coverage: 1:341/353 of query aligns to 5:353/378 of Q9LKJ1
- G70 (= G67) mutation to S: Loss of activity.
- E142 (= E144) mutation to A: Loss of activity.
- D150 (= D152) mutation to G: Reduced activity.
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
43% identity, 99% coverage: 4:352/353 of query aligns to 1:338/340 of 4hdtA
- active site: G64 (= G67), I69 (≠ L72), W84 (≠ F93), Y88 (= Y97), G112 (= G121), G115 (= G124), E135 (= E144), P142 (= P151), D143 (= D152), R283 (≠ V292)
- binding zinc ion: H28 (≠ L31), E42 (≠ D45), E57 (= E60), E79 (≠ P88), H93 (≠ L102), H185 (≠ S194)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
33% identity, 54% coverage: 10:198/353 of query aligns to 9:188/259 of 5zaiC
- active site: A65 (≠ G67), F70 (≠ L72), S82 (≠ A79), R86 (= R83), G110 (= G121), E113 (≠ G124), P132 (= P143), E133 (= E144), I138 (≠ L149), P140 (= P151), G141 (≠ D152)
- binding coenzyme a: K24 (≠ A25), L25 (= L26), A63 (= A65), G64 (= G66), A65 (≠ G67), D66 (= D68), I67 (≠ V69), P132 (= P143), R166 (= R176)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
36% identity, 53% coverage: 7:193/353 of query aligns to 5:178/254 of 2dubA
- active site: A67 (≠ G67), M72 (≠ G82), S82 (≠ V98), G105 (= G121), E108 (≠ G124), P127 (= P143), E128 (= E144), T133 (≠ L149), P135 (= P151), G136 (≠ D152)
- binding octanoyl-coenzyme a: K25 (= K24), A26 (= A25), L27 (= L26), A29 (= A28), A65 (= A65), A67 (≠ G67), D68 (= D68), I69 (≠ V69), K70 (= K80), G105 (= G121), E108 (≠ G124), P127 (= P143), E128 (= E144), G136 (≠ D152), A137 (≠ V153)
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
35% identity, 53% coverage: 7:193/353 of query aligns to 6:184/260 of 1dubA
- active site: A68 (≠ G67), M73 (≠ G82), S83 (= S94), L87 (≠ V98), G111 (= G121), E114 (≠ G124), P133 (= P143), E134 (= E144), T139 (≠ L149), P141 (= P151), G142 (≠ D152)
- binding acetoacetyl-coenzyme a: K26 (= K24), A27 (= A25), L28 (= L26), A30 (= A28), A66 (= A65), A68 (≠ G67), D69 (= D68), I70 (≠ V69), Y107 (≠ I117), G110 (= G120), G111 (= G121), E114 (≠ G124), P133 (= P143), E134 (= E144), L137 (≠ I147), G142 (≠ D152)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
35% identity, 53% coverage: 7:193/353 of query aligns to 4:182/258 of 1ey3A
- active site: A66 (≠ G67), M71 (≠ G82), S81 (= S94), L85 (≠ V98), G109 (= G121), E112 (≠ G124), P131 (= P143), E132 (= E144), T137 (≠ L149), P139 (= P151), G140 (≠ D152)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (= K24), L26 (= L26), A28 (= A28), A64 (= A65), G65 (= G66), A66 (≠ G67), D67 (= D68), I68 (≠ V69), L85 (≠ V98), W88 (vs. gap), G109 (= G121), P131 (= P143), L135 (≠ I147), G140 (≠ D152)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
35% identity, 53% coverage: 7:193/353 of query aligns to 36:214/290 of P14604
- E144 (≠ G124) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E144) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
36% identity, 53% coverage: 7:193/353 of query aligns to 6:182/258 of 1mj3A
- active site: A68 (≠ G67), M73 (≠ G82), S83 (≠ V98), L85 (= L99), G109 (= G121), E112 (≠ G124), P131 (= P143), E132 (= E144), T137 (≠ L149), P139 (= P151), G140 (≠ D152)
- binding hexanoyl-coenzyme a: K26 (= K24), A27 (= A25), L28 (= L26), A30 (= A28), A66 (= A65), G67 (= G66), A68 (≠ G67), D69 (= D68), I70 (≠ V69), G109 (= G121), P131 (= P143), E132 (= E144), L135 (≠ I147), G140 (≠ D152)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
33% identity, 53% coverage: 7:193/353 of query aligns to 6:184/260 of 2hw5C
- active site: A68 (≠ G67), M73 (≠ L72), S83 (= S94), L87 (≠ V98), G111 (= G121), E114 (≠ G124), P133 (= P143), E134 (= E144), T139 (≠ L149), P141 (= P151), G142 (≠ D152)
- binding crotonyl coenzyme a: K26 (= K24), A27 (= A25), L28 (= L26), A30 (= A28), K62 (= K61), I70 (≠ V69), F109 (≠ M119)
Sites not aligning to the query:
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
33% identity, 54% coverage: 7:197/353 of query aligns to 5:185/257 of 6slbAAA
- active site: Q64 (≠ G67), F69 (≠ L72), L80 (≠ S94), N84 (= N100), A108 (≠ G121), S111 (≠ G124), A130 (≠ P143), F131 (≠ E144), L136 (= L149), P138 (= P151), D139 (= D152)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K61), A62 (= A65), Q64 (≠ G67), D65 (= D68), L66 (≠ V69), Y76 (≠ R90), A108 (≠ G121), F131 (≠ E144), D139 (= D152)
Sites not aligning to the query:
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 54% coverage: 8:196/353 of query aligns to 11:193/266 of O53561
- K135 (≠ L139) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 139:146, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ G146) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
31% identity, 54% coverage: 7:197/353 of query aligns to 2:173/245 of 6slaAAA
- active site: Q61 (≠ G67), L68 (≠ I89), N72 (= N100), A96 (≠ G121), S99 (≠ G124), A118 (≠ P143), F119 (≠ E144), L124 (= L149), P126 (= P151), N127 (≠ D152)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L26), A59 (= A65), Q61 (≠ G67), D62 (= D68), L63 (≠ V69), L68 (≠ I89), Y71 (≠ F92), A94 (≠ M119), G95 (= G120), A96 (≠ G121), F119 (≠ E144), I122 (= I147), L124 (= L149), N127 (≠ D152)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
30% identity, 54% coverage: 7:197/353 of query aligns to 5:184/256 of 3h81A
- active site: A64 (≠ G67), M69 (≠ L72), T79 (≠ F93), F83 (≠ Y97), G107 (= G121), E110 (≠ G124), P129 (= P143), E130 (= E144), V135 (≠ L149), P137 (= P151), G138 (≠ D152)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
30% identity, 54% coverage: 7:197/353 of query aligns to 6:185/255 of 3q0jC
- active site: A65 (≠ G67), M70 (≠ L72), T80 (≠ F93), F84 (≠ Y97), G108 (= G121), E111 (≠ G124), P130 (= P143), E131 (= E144), V136 (≠ L149), P138 (= P151), G139 (≠ D152)
- binding acetoacetyl-coenzyme a: Q23 (≠ K24), A24 (= A25), L25 (= L26), A27 (= A28), A63 (= A65), G64 (= G66), A65 (≠ G67), D66 (= D68), I67 (≠ V69), K68 (≠ V70), M70 (≠ L72), F84 (≠ Y97), G107 (= G120), G108 (= G121), E111 (≠ G124), P130 (= P143), E131 (= E144), P138 (= P151), G139 (≠ D152), M140 (≠ V153)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 54% coverage: 7:197/353 of query aligns to 6:185/255 of 3q0gC
- active site: A65 (≠ G67), M70 (≠ L72), T80 (≠ F93), F84 (≠ Y97), G108 (= G121), E111 (≠ G124), P130 (= P143), E131 (= E144), V136 (≠ L149), P138 (= P151), G139 (≠ D152)
- binding coenzyme a: L25 (= L26), A63 (= A65), I67 (≠ V69), K68 (≠ V70), Y104 (≠ I117), P130 (= P143), E131 (= E144), L134 (≠ I147)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 54% coverage: 7:197/353 of query aligns to 5:180/250 of 3q0gD
- active site: A64 (≠ G67), M69 (≠ L72), T75 (≠ F93), F79 (≠ Y97), G103 (= G121), E106 (≠ G124), P125 (= P143), E126 (= E144), V131 (≠ L149), P133 (= P151), G134 (≠ D152)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
30% identity, 54% coverage: 6:197/353 of query aligns to 6:189/261 of 5jbxB
- active site: A67 (≠ G67), R72 (≠ A75), L84 (≠ F93), R88 (≠ Y97), G112 (= G121), E115 (≠ G124), T134 (≠ P143), E135 (= E144), I140 (≠ L149), P142 (= P151), G143 (≠ D152)
- binding coenzyme a: S24 (≠ K24), R25 (≠ A25), R26 (≠ L26), A28 (= A28), A65 (= A65), D68 (= D68), L69 (= L72), K70 (≠ Y73), L110 (≠ M119), G111 (= G120), T134 (≠ P143), E135 (= E144), L138 (≠ I147), R168 (= R176)
Sites not aligning to the query:
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
31% identity, 59% coverage: 12:218/353 of query aligns to 8:197/723 of Q08426
- V40 (≠ D45) to G: in dbSNP:rs1062551
- I41 (≠ A46) to R: in dbSNP:rs1062552
- T75 (≠ S94) to I: in dbSNP:rs1062553
- K165 (≠ A184) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ A190) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- 274 A → T: in dbSNP:rs2302819
- 325 A → G: in dbSNP:rs1062555
- 346 modified: N6-acetyllysine; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- 584 modified: N6-acetyllysine; alternate; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- 598 K → T: in dbSNP:rs1042437
- 606 T → P: in dbSNP:rs1042438
6eqoA Tri-functional propionyl-coa synthase of erythrobacter sp. Nap1 with bound NADP+ and phosphomethylphosphonic acid adenylate ester (see paper)
30% identity, 50% coverage: 15:191/353 of query aligns to 867:1043/1804 of 6eqoA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 456, 458, 535, 536, 537, 538, 558, 559, 560, 561, 562, 688, 714
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 1261, 1265, 1379, 1400, 1403, 1404, 1405, 1424, 1425, 1429, 1444, 1492, 1493, 1497, 1514, 1517, 1713, 1730, 1731, 1774
Query Sequence
>WP_012974023.1 NCBI__GCF_000010725.1:WP_012974023.1
MSDDAEILFERRGAIGLVTLNRPKALNALTLGMIRLFDPQLRAWDADPEVKAVVIRGAGE
KAFCAGGDVVSLYEAGKAAKEGRGDTSPIRAFFSEEYVLNRLIKRLSKPYVAVIDGISMG
GGVGLSVHGSHRIVTERTLFAMPETGIGLYPDVGGTYFLPRLPGQVGVWLGLTGDRLKAA
DLLAIGAADAFVPSGEIDGLIGDLAAGRPADEAIATRRGDAGEAMVRALRAVIDRCYAFD
SVEAIVKALEAEGGDWANGQLATLRRVSPTSLKVTLAALRRGAGLDFDGCMVQELRLSLA
CLAGVDFYEGIRAVLVDKDKSPKWKPANLADVGPSDVARHFTEPAGGDLLFRD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory