Comparing WP_012991849.1 NCBI__GCF_000025605.1:WP_012991849.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
62% identity, 97% coverage: 2:250/256 of query aligns to 3:252/253 of 1h5yB
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
57% identity, 98% coverage: 1:252/256 of query aligns to 1:251/253 of Q9X0C6
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
57% identity, 98% coverage: 1:252/256 of query aligns to 1:251/252 of 7ac8A
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
56% identity, 98% coverage: 1:252/256 of query aligns to 1:251/253 of 1gpwC
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
55% identity, 97% coverage: 2:250/256 of query aligns to 2:249/250 of 7qc8A
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
55% identity, 98% coverage: 1:252/256 of query aligns to 1:242/244 of 3zr4E
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
55% identity, 97% coverage: 2:250/256 of query aligns to 1:242/243 of 4ewnD
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
51% identity, 98% coverage: 3:254/256 of query aligns to 1:251/251 of 5d2tA
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
54% identity, 98% coverage: 1:252/256 of query aligns to 1:237/237 of 2wjzE
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
51% identity, 98% coverage: 2:252/256 of query aligns to 1:250/250 of 6dnjA
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 1:250/256 of query aligns to 1:256/258 of P60664
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
49% identity, 98% coverage: 2:252/256 of query aligns to 2:250/262 of 3iivB
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
40% identity, 98% coverage: 2:252/256 of query aligns to 239:532/532 of 1ox5A
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
40% identity, 98% coverage: 2:252/256 of query aligns to 239:538/538 of 1ox4B
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 99% coverage: 2:254/256 of query aligns to 236:552/552 of P33734
3tdmA Computationally designed tim-barrel protein, halfflr (see paper)
54% identity, 36% coverage: 123:214/256 of query aligns to 1:92/120 of 3tdmA
Sites not aligning to the query:
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
33% identity, 79% coverage: 6:208/256 of query aligns to 2:206/241 of 5ab3A
Sites not aligning to the query:
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
30% identity, 79% coverage: 6:208/256 of query aligns to 2:209/246 of 5abtA
Sites not aligning to the query:
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
27% identity, 83% coverage: 6:218/256 of query aligns to 5:216/244 of 3zs4A
Sites not aligning to the query:
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
27% identity, 83% coverage: 6:218/256 of query aligns to 5:207/234 of 2y85A
Sites not aligning to the query:
>WP_012991849.1 NCBI__GCF_000025605.1:WP_012991849.1
MLAKRIIPCLDVDKGRVVKGVRFQNLVDAGDPVQIAAEYERQGADELVFLDITASAENRK
TMIEVVREVAQTVFMPFTVGGGVSTLEDIRLLLSAGADKVSINTAAVKNPQLVYEAARRF
GSQCVVVAIDAKRKGNSWEVYIHGGRTPTGIDAVEWARRVEELGAGEILLTSMDTDGTKR
GYDIELCKAVANAVKIPVIASGGAGRMEHFYQVFSMTHVSAALAASLFHFGEVLIPDLKR
YLKERGVTVRYDYEEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory