Comparing WP_012991929.1 NCBI__GCF_000025605.1:WP_012991929.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
37% identity, 84% coverage: 4:258/303 of query aligns to 12:264/295 of 6cyzA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
28% identity, 85% coverage: 1:258/303 of query aligns to 1:270/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 96% coverage: 2:293/303 of query aligns to 54:363/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
24% identity, 84% coverage: 2:257/303 of query aligns to 3:264/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
24% identity, 84% coverage: 2:257/303 of query aligns to 3:264/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
24% identity, 84% coverage: 2:257/303 of query aligns to 3:264/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
24% identity, 84% coverage: 2:257/303 of query aligns to 3:264/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
24% identity, 84% coverage: 2:257/303 of query aligns to 3:264/296 of 1fwkA
>WP_012991929.1 NCBI__GCF_000025605.1:WP_012991929.1
MIKIVVPASTSNLGPGFDTFGLALGLYNIFLVERHPSYRVCVIGEGTHLPRDTGNLMVMA
YRMACSRWGVEEVPLKVIQINRVPTARGLGSSATAIVGGITACERIHNLRKRVEEKVEVA
LELEPHPDNILPALVGGLVVCAKGEEGISFVKLDFPEDLRVVVCVPSVEVSTEEARRVLR
GDVSLQDAVFNVQRSCLLLASLMTRRYSLLKEAVKDRLHQPYRSRLVPAMYTVMEEAYTA
GALASFLSGSGPTVASLCQGNCEKVGQAMVRAFKKAGVEAKYMVLQVDREGTRCHEDTDV
GHR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory