SitesBLAST
Comparing WP_012992396.1 NCBI__GCF_000025605.1:WP_012992396.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P0A6X1 Glutamyl-tRNA reductase; GluTR; EC 1.2.1.70 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 81% coverage: 1:331/409 of query aligns to 1:336/418 of P0A6X1
- G7 (= G7) mutation to D: Loss of activity.
- T49 (= T49) mutation to V: 10% and 5% of wild-type reductase and esterase activity, respectively.
- C50 (= C50) mutation to S: Loss of activity.
- R52 (= R52) mutation to K: 5% and 4% of wild-type reductase and esterase activity, respectively.; mutation to Q: Loss of activity.
- E54 (= E54) mutation to K: 6% and 2% of wild-type reductase and esterase activity, respectively.
- C74 (vs. gap) mutation to S: No effect.
- H99 (= H95) mutation to N: 5% and 4% of wild-type reductase and esterase activity, respectively.
- G106 (≠ S102) mutation to N: Loss of activity.
- S109 (= S105) mutation to A: 28% and 25% of wild-type reductase and esterase activity, respectively.
- E114 (= E110) mutation to K: Loss of activity.
- Q116 (= Q112) mutation to L: Loss of reductase activity. 30% of wild-type esterase activity.
- S145 (≠ A141) mutation to F: Loss of activity.
- C170 (≠ V166) mutation to S: No effect.
- G191 (= G187) mutation to D: Loss of reductase activity. Retains esterase activity.
- R314 (= R309) mutation to C: Loss of activity.
Q9UXR8 Glutamyl-tRNA reductase; GluTR; EC 1.2.1.70 from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) (see paper)
38% identity, 78% coverage: 2:320/409 of query aligns to 3:311/404 of Q9UXR8
- C48 (= C50) mutation to S: Complete loss of activity.
- H84 (= H95) mutation to A: Complete loss of activity.; mutation to N: 30% of wild-type reductase activity. 15% of wild-type esterase activity.
1gpjA Glutamyl-tRNA reductase from methanopyrus kandleri (see paper)
38% identity, 78% coverage: 2:320/409 of query aligns to 3:311/399 of 1gpjA
- active site: S48 (≠ C50), H84 (= H95)
- binding glutamic acid: T47 (= T49), N49 (= N51), R50 (= R52), S94 (= S105), E99 (= E110), E101 (≠ Q112), I102 (= I113), Q105 (= Q116)
- binding (2r,3r,4s,5s)-4-amino-2-[6-(dimethylamino)-9h-purin-9-yl]-5-(hydroxymethyl)tetrahydro-3-furanol: S48 (≠ C50), E101 (≠ Q112)
5yjlB Crystal structure of arabidopsis glutamyl-tRNA reductase in complex with NADPH and gbp (see paper)
34% identity, 86% coverage: 2:353/409 of query aligns to 2:355/415 of 5yjlB
- active site: C50 (= C50), H99 (= H95)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C50 (= C50), A162 (= A158), G187 (= G187), K188 (≠ E188), M189 (= M189), N209 (= N208), R210 (= R209), S211 (≠ T210), R214 (≠ K213), T249 (= T245), A250 (≠ G246), S251 (= S247), I280 (= I274), V282 (= V276)
Query Sequence
>WP_012992396.1 NCBI__GCF_000025605.1:WP_012992396.1
MDILVWGINFKTAPVELREKLACGQEETPHILKLLASASGLKELMILSTCNRVELYMVGS
AQDAKRAVEVYTDIKGADVGKNISFFLEKERAVAHIFMVASSLDSMVVGEPQIVRQFKDA
YLLARQASTVGKILNRLYQHALKTAKRVRTETAIARNAVSVSYVAVDLARRIFGDLRKAR
VLLVGAGEMAQLAARYFRKMGASIFISNRTYEKAVDVAKSLDGNVIRFEELGEHLHTFDI
VLVSTGSKDYVIRKDTIKNAIKRREYRPMFIIDISVPRNVDPEVNQLDEVFLYDIDDLRT
VAESNLRDRLKEKEKGEIIVWDEVRKFMKWLDLLKLEDKIVKLLETWRDVAEREPKVRKL
LHTVLEEIRKDPSSADRWFKILLQEEVLDYGNSFRRIPYVHNRTDGTGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory