SitesBLAST
Comparing WP_012992548.1 NCBI__GCF_000025605.1:WP_012992548.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
45% identity, 96% coverage: 8:421/433 of query aligns to 9:418/438 of Q83E11
- KS 21:22 (= KS 20:21) binding
- R26 (= R25) binding
- NSGT 93:96 (= NSGT 89:92) Phosphoenolpyruvate
- R123 (= R119) binding
- D315 (= D317) active site, Proton acceptor
- K342 (= K344) binding
- R346 (= R348) binding
- R387 (= R390) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
45% identity, 96% coverage: 8:421/433 of query aligns to 11:420/440 of 3slhD
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N95 (= N89), R125 (= R119), D317 (= D317), E345 (= E345), H388 (= H389), R389 (= R390), T415 (≠ V416)
- binding glyphosate: K23 (= K20), G97 (= G91), T98 (= T92), R125 (= R119), Q171 (= Q166), D317 (= D317), E345 (= E345), R348 (= R348), H388 (= H389), R389 (= R390)
- binding shikimate-3-phosphate: S24 (= S21), R28 (= R25), S169 (= S164), Q171 (= Q166), R196 (= R191), D317 (= D317), K344 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S21), R28 (= R25), T98 (= T92), Q171 (= Q166), R196 (= R191), D317 (= D317), K344 (= K344)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
44% identity, 96% coverage: 8:421/433 of query aligns to 11:416/434 of 4egrA
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N95 (= N89), R125 (= R119), D313 (= D317), E341 (= E345), H384 (= H389), R385 (= R390), T411 (≠ V416)
- binding phosphoenolpyruvate: K23 (= K20), G97 (= G91), T98 (= T92), R125 (= R119), D313 (= D317), E341 (= E345), R344 (= R348), R385 (= R390)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
40% identity, 97% coverage: 6:425/433 of query aligns to 6:421/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
40% identity, 97% coverage: 6:425/433 of query aligns to 6:421/427 of 1rf6A
- active site: K20 (= K20), S21 (= S21), D47 (= D47), N90 (= N89), D115 (≠ S114), R120 (= R119), D312 (= D317), E340 (= E345), H384 (= H389), R385 (= R390), T412 (≠ V416)
- binding glyphosate: K20 (= K20), G92 (= G91), T93 (= T92), R120 (= R119), Q168 (= Q166), D312 (= D317), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S21 (= S21), R25 (= R25), S166 (= S164), Q168 (= Q166), R193 (= R191), I311 (= I316), D312 (= D317), K339 (= K344)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
40% identity, 97% coverage: 6:425/433 of query aligns to 6:421/427 of 1rf4A
- active site: K20 (= K20), S21 (= S21), D47 (= D47), N90 (= N89), D115 (≠ S114), R120 (= R119), D312 (= D317), E340 (= E345), H384 (= H389), R385 (= R390), T412 (≠ V416)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K20), S21 (= S21), R25 (= R25), G92 (= G91), T93 (= T92), R120 (= R119), S166 (= S164), A167 (= A165), Q168 (= Q166), R193 (= R191), D312 (= D317), K339 (= K344), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
41% identity, 98% coverage: 5:428/433 of query aligns to 13:443/455 of Q9R4E4
- KS 28:29 (= KS 20:21) binding
- R33 (= R25) binding
- NAAT 98:101 (≠ NSGT 89:92) Phosphoenolpyruvate
- A100 (≠ G91) mutation to G: Confers resistance to glyphosate.
- R128 (= R119) binding
- K353 (= K344) binding
- R357 (= R348) binding
- R405 (= R390) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
41% identity, 98% coverage: 5:428/433 of query aligns to 8:438/445 of 2pqcA
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N93 (= N89), R123 (= R119), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (≠ V416)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K20), S24 (= S21), R28 (= R25), T96 (= T92), R123 (= R119), S168 (= S164), Q170 (= Q166), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R390)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
41% identity, 98% coverage: 5:428/433 of query aligns to 8:438/445 of 2pqbA
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N93 (= N89), R123 (= R119), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (≠ V416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K20), S24 (= S21), R28 (= R25), A95 (≠ G91), T96 (= T92), R123 (= R119), S168 (= S164), Q170 (= Q166), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R390)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
41% identity, 98% coverage: 5:428/433 of query aligns to 8:438/445 of 2ggaA
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N93 (= N89), R123 (= R119), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (≠ V416)
- binding glyphosate: K23 (= K20), A94 (≠ S90), A95 (≠ G91), T96 (= T92), R123 (= R119), D321 (= D317), E349 (= E345), R352 (= R348), R400 (= R390)
- binding shikimate-3-phosphate: S24 (= S21), R28 (= R25), S168 (= S164), A169 (= A165), Q170 (= Q166), R195 (= R191), D321 (= D317), K348 (= K344)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
41% identity, 98% coverage: 5:428/433 of query aligns to 8:438/445 of 2gg6A
- active site: K23 (= K20), S24 (= S21), D50 (= D47), N93 (= N89), R123 (= R119), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (≠ V416)
- binding shikimate-3-phosphate: S24 (= S21), R28 (= R25), T96 (= T92), S168 (= S164), Q170 (= Q166), D321 (= D317), K348 (= K344)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 100% coverage: 2:432/433 of query aligns to 3:426/426 of 7tm6A
- binding glyphosate: K21 (= K20), G95 (= G91), R123 (= R119), Q170 (= Q166), D312 (= D317), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S22 (= S21), R26 (= R25), T96 (= T92), S168 (= S164), S169 (≠ A165), Q170 (= Q166), S196 (≠ E185), Y199 (≠ V188), D312 (= D317), N335 (≠ E340), K339 (= K344)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 100% coverage: 2:432/433 of query aligns to 4:427/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K20), S23 (= S21), R27 (= R25), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (≠ E185), Y200 (≠ V188), D313 (= D317), N336 (≠ E340), K340 (= K344)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
27% identity, 99% coverage: 2:429/433 of query aligns to 4:425/426 of 3nvsA
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), H128 (≠ R123), Q135 (= Q130), Y142 (≠ G137), E144 (= E139), A247 (= A238), A255 (≠ L246), D314 (= D317), E342 (= E345), H386 (= H389), R387 (= R390), K412 (≠ V416)
- binding glyphosate: K22 (= K20), G96 (= G91), R124 (= R119), Q172 (= Q166), D314 (= D317), E342 (= E345), R345 (= R348), H386 (= H389), R387 (= R390)
- binding magnesium ion: E123 (≠ K118), Q145 (≠ R140)
- binding shikimate-3-phosphate: K22 (= K20), S23 (= S21), R27 (= R25), T97 (= T92), S170 (= S164), S171 (≠ A165), Q172 (= Q166), S198 (≠ E185), Y201 (≠ V188), D314 (= D317), N337 (≠ E340), K341 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S21), R27 (= R25), Q172 (= Q166), Y201 (≠ V188), D314 (= D317), K341 (= K344)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
27% identity, 99% coverage: 2:429/433 of query aligns to 4:425/426 of Q9KRB0
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
30% identity, 99% coverage: 2:430/433 of query aligns to 4:425/427 of 2pq9A
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ V416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K20), S23 (= S21), R27 (= R25), G96 (= G91), T97 (= T92), R124 (= R119), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S190), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H389), R386 (= R390), K411 (≠ V416)
2aa9A Epsp synthase liganded with shikimate (see paper)
30% identity, 99% coverage: 2:430/433 of query aligns to 4:425/427 of 2aa9A
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ V416)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K20), S23 (= S21), R27 (= R25), T97 (= T92), Q171 (= Q166), Y200 (vs. gap), D313 (= D317), K340 (= K344)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
30% identity, 99% coverage: 2:430/433 of query aligns to 4:425/427 of 1x8tA
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ V416)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K20), S23 (= S21), R27 (= R25), T97 (= T92), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S190), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H389), R386 (= R390)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
30% identity, 99% coverage: 2:430/433 of query aligns to 4:425/427 of 1x8rA
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ V416)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K20), S23 (= S21), R27 (= R25), G96 (= G91), T97 (= T92), R124 (= R119), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S190), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), E341 (= E345), H385 (= H389), K411 (≠ V416)
1g6tA Structure of epsp synthase liganded with shikimate-3-phosphate (see paper)
30% identity, 99% coverage: 2:430/433 of query aligns to 4:425/427 of 1g6tA
- active site: K22 (= K20), S23 (= S21), D49 (= D47), N94 (= N89), P119 (≠ S114), R124 (= R119), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ V416)
- binding phosphate ion: K22 (= K20), G96 (= G91), T97 (= T92), R124 (= R119), Q171 (= Q166), E341 (= E345), K411 (≠ V416)
- binding shikimate-3-phosphate: K22 (= K20), S23 (= S21), R27 (= R25), T97 (= T92), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S190), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344)
Query Sequence
>WP_012992548.1 NCBI__GCF_000025605.1:WP_012992548.1
MLKVRKVKKVRGELRVPSDKSVSHRAVILSAMAEGESVVHDWLISADTLATLRAVRALGT
KVQRKGATLRIWGRAMRFQEPSDVLNAQNSGTTARLLMGLLATQPFFSTITGDSSLRKRP
MLRVVEPLRQMGAWLDGRERGNKLPVSVRGGTLKGISFFNVKASAQVKSAILLAGLGAEG
YTQVEEPVLSRDHTERMLKLFGVEVLTLDTEKGRMVKIEGGQIPKSAEVFCPADPSSAAF
FVALALLVDDSEVLLKDVMVNPTRDGFFRKVRQMGGEIYYENLREISGEPIADIRVVGGR
KLKGVEVKGEEVPSLIDEIPVLSVLMALAEGRSRVKGASELRVKESDRIRAVVENLRSMG
AKVEELEDGFEIEGVSSLKGAFIKTYGDHRIAMAFTVAGLVAEGETVIDNPHCVAVSYPD
FYRDLAGITEMSF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory