Comparing WP_012992553.1 NCBI__GCF_000025605.1:WP_012992553.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
38% identity, 90% coverage: 29:378/387 of query aligns to 15:367/380 of 2x5dD
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
40% identity, 99% coverage: 5:387/387 of query aligns to 6:389/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
40% identity, 99% coverage: 5:387/387 of query aligns to 6:389/392 of 6l1oB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
40% identity, 99% coverage: 5:387/387 of query aligns to 6:388/393 of 6l1nA
2o1bA Structure of aminotransferase from staphylococcus aureus
40% identity, 91% coverage: 33:385/387 of query aligns to 21:371/376 of 2o1bA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
33% identity, 93% coverage: 27:385/387 of query aligns to 20:381/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
33% identity, 93% coverage: 27:385/387 of query aligns to 20:381/388 of 1gd9A
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
32% identity, 98% coverage: 8:385/387 of query aligns to 5:391/393 of 3jtxB
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
31% identity, 98% coverage: 5:382/387 of query aligns to 11:378/384 of 1o4sB
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
28% identity, 92% coverage: 30:385/387 of query aligns to 30:389/391 of 8wkjA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/385 of Q56232
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
30% identity, 99% coverage: 1:385/387 of query aligns to 1:381/382 of 1gc3A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 95% coverage: 15:382/387 of query aligns to 21:391/402 of P14909
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
28% identity, 99% coverage: 4:385/387 of query aligns to 3:383/388 of 1j32A
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
29% identity, 92% coverage: 28:382/387 of query aligns to 26:364/370 of Q58097
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 99% coverage: 1:385/387 of query aligns to 1:395/400 of Q02635
>WP_012992553.1 NCBI__GCF_000025605.1:WP_012992553.1
MWSFSQRIQQLPPYLFAQIDRKKREKIAQGADVIDLGVGDPDLPTPEPIVRAMQKAVENP
QHHRYPSYEGMFSFRQAVSDWYKRRFGVELDPEKEVIALIGSKEGIAHFPLAFVDPGDVV
LCPDPAYPVYKIGTIFAGGEPYFLPLKEENGFLPDFRSVPQDVLKRAKIIWVNYPNNPTS
VTATLDFYKELVEWAHQHNIIVASDLAYSEVYFGEEKPPSILQVEGAKEVAIEFHSLSKT
FNMTGWRIGMAVGNRRLIEGLGKVKTNVDSGQFQAIQEAAIAALSLPEEALKPIRDTYAE
RRRVMTEALKNIGLEVVPSEATFYLWVKVPKGYTSAQFVERLLDECAIVCTPGNGFGEAG
EGYFRISLTVPTHRLLEAADRIGKLKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory