Comparing WP_013009503.1 NCBI__GCF_000025725.1:WP_013009503.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 98% coverage: 6:322/323 of query aligns to 8:355/364 of P97084
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
29% identity, 98% coverage: 6:322/323 of query aligns to 2:349/356 of 1lc8A
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
29% identity, 98% coverage: 6:322/323 of query aligns to 5:352/358 of 1lc7A
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
29% identity, 98% coverage: 6:322/323 of query aligns to 1:348/355 of 1lkcA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
27% identity, 84% coverage: 22:293/323 of query aligns to 28:321/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
27% identity, 84% coverage: 22:293/323 of query aligns to 28:321/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
26% identity, 82% coverage: 28:293/323 of query aligns to 19:307/335 of 1geyA
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
26% identity, 84% coverage: 22:293/323 of query aligns to 28:321/353 of 7szpA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 67% coverage: 56:272/323 of query aligns to 56:299/354 of 3ly1D
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
25% identity, 89% coverage: 13:298/323 of query aligns to 23:334/360 of 8bj3A
Sites not aligning to the query:
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 50% coverage: 71:231/323 of query aligns to 73:240/328 of 1uu0A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
30% identity, 50% coverage: 71:231/323 of query aligns to 80:247/335 of 2f8jA
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 50% coverage: 71:231/323 of query aligns to 74:241/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
30% identity, 50% coverage: 71:231/323 of query aligns to 74:241/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 50% coverage: 71:231/323 of query aligns to 79:246/335 of Q9X0D0
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
28% identity, 53% coverage: 121:292/323 of query aligns to 148:322/353 of 4r5zA
Sites not aligning to the query:
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
28% identity, 53% coverage: 121:292/323 of query aligns to 148:322/353 of 4r2nA
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
23% identity, 83% coverage: 28:295/323 of query aligns to 33:336/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
23% identity, 83% coverage: 28:295/323 of query aligns to 31:334/364 of 3cq6A
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
30% identity, 61% coverage: 124:320/323 of query aligns to 175:375/384 of 1o4sB
Sites not aligning to the query:
>WP_013009503.1 NCBI__GCF_000025725.1:WP_013009503.1
MRQGEHGGDIHEVANYLGVPASDVYDYSSNVSPYPIDISVDKSALSRLPEPYSRTLAKAF
AEKYGYDEKMVCITAGTTEAIDIICRIFAGKSACIKNPTYADYKKFCKNNKITVRNSLPV
ELYFICNPNNPTGQTCPREFLPTYFKTSPSTLFVIDESYMPFHIDEPMQTLMGEKLDNIA
ILRSFSKIYGLPGLRLGAVIANEKLIEKMKNQMSPWSVNSLAQSAGLELLDVDTAPIAKR
LNDIKVQFLKELESIDFLEAVDSDVNYMMCKMKRGTSDELFRHCLNQRVLIRDCSNFEGL
DNRHVRFAMADDMSPLLEALKSF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory