Comparing WP_013009628.1 NCBI__GCF_000025725.1:WP_013009628.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
46% identity, 87% coverage: 3:99/111 of query aligns to 8:104/200 of 6j2lA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
43% identity, 95% coverage: 4:108/111 of query aligns to 9:112/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
44% identity, 93% coverage: 4:106/111 of query aligns to 11:112/213 of 7bgmA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
41% identity, 94% coverage: 3:106/111 of query aligns to 7:113/185 of 6j2lB
Sites not aligning to the query:
>WP_013009628.1 NCBI__GCF_000025725.1:WP_013009628.1
MIKIDWKKQGGLLPAIAQDVETKEVLMLAYVNKDALRLSFETGYAHYYSRSRDQLWKKGE
TSGHLQKIVSVFLDCDGDTILYLVNQTGAACHTGERTCFFTRLEDVGESDT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory