SitesBLAST
Comparing WP_013010405.1 NCBI__GCF_000025725.1:WP_013010405.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
43% identity, 100% coverage: 2:440/441 of query aligns to 8:443/448 of 3du4A
- active site: F17 (≠ C11), Y146 (= Y141), E217 (= E213), D251 (= D247), A254 (= A250), K280 (= K276), A417 (≠ Y414)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A77), Y146 (= Y141), G315 (≠ S311), S317 (= S313), R410 (= R407)
- binding pyridoxal-5'-phosphate: S112 (≠ I107), G113 (= G108), A114 (≠ S109), Y146 (= Y141), H147 (= H142), E217 (= E213), D251 (= D247), V253 (≠ I249), A254 (= A250), K280 (= K276), H316 (= H312), S317 (= S313)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
43% identity, 100% coverage: 2:440/441 of query aligns to 8:443/448 of P53555
- GA 113:114 (≠ GS 108:109) binding
- Y146 (= Y141) binding
- K280 (= K276) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S311) binding
- HS 316:317 (= HS 312:313) binding
- R410 (= R407) binding
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
40% identity, 98% coverage: 7:439/441 of query aligns to 13:435/438 of 6zhkA
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
40% identity, 100% coverage: 2:440/441 of query aligns to 5:415/420 of 6wnnA
- active site: F14 (≠ C11), Y143 (= Y141), D223 (= D247), K252 (= K276)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (≠ C11), W51 (= W49), S109 (≠ I107), G110 (= G108), A111 (≠ S109), Y143 (= Y141), H144 (= H142), D223 (= D247), V225 (≠ I249), K252 (= K276), R382 (= R407)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H312), S289 (= S313)
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
39% identity, 100% coverage: 2:440/441 of query aligns to 6:412/417 of 3dodA
- active site: F15 (≠ C11), E186 (= E213), D220 (= D247), A223 (= A250), K249 (= K276), A386 (≠ Y414)
- binding pyridoxal-5'-phosphate: W52 (= W49), S110 (≠ I107), G111 (= G108), A112 (≠ S109), D220 (= D247), V222 (≠ I249), K249 (= K276), H285 (= H312), S286 (= S313)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
37% identity, 96% coverage: 6:429/441 of query aligns to 13:405/420 of 6erkA
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
35% identity, 98% coverage: 6:437/441 of query aligns to 12:421/429 of 6ed7A
- active site: Y17 (≠ C11), Y144 (= Y141), D245 (= D247), K274 (= K276)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ C11), W52 (= W48), W52 (= W48), Y144 (= Y141), D147 (≠ E144), A217 (= A219), K274 (= K276), R391 (= R407), F393 (≠ L409), F393 (≠ L409)
- binding pyridoxal-5'-phosphate: G112 (= G108), S113 (= S109), Y144 (= Y141), H145 (= H142), D245 (= D247), I247 (= I249), K274 (= K276)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 98% coverage: 6:437/441 of query aligns to 12:421/429 of P12995
- Y17 (≠ C11) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W48) binding
- GS 112:113 (= GS 108:109) binding
- Y144 (= Y141) mutation to F: Severely reduces the aminotransferase activity.
- D147 (≠ E144) mutation to N: Loss of aminotransferase activity.
- D245 (= D247) binding
- R253 (= R255) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K276) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S311) binding
- PT 308:309 (≠ HS 312:313) binding
- R391 (= R407) binding ; mutation to A: Reduces aminotransferase activity.
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:414/427 of 4cxqA
- active site: Y18 (≠ C11), Y149 (= Y141), E212 (= E213), D246 (= D247), A249 (= A250), K275 (= K276), Y399 (= Y414)
- binding 7-keto-8-aminopelargonic acid: W56 (= W48), Y149 (= Y141), G308 (≠ S311), T310 (≠ S313), R392 (= R407)
- binding pyridoxal-5'-phosphate: G116 (= G108), S117 (= S109), Y149 (= Y141), H150 (= H142), G151 (= G143), E212 (= E213), D246 (= D247), I248 (= I249), K275 (= K276), P309 (≠ H312), T310 (≠ S313)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
35% identity, 98% coverage: 6:437/441 of query aligns to 12:421/429 of 1dtyA
- active site: Y17 (≠ C11), Y144 (= Y141), E211 (= E213), D245 (= D247), A248 (= A250), K274 (= K276), Y398 (= Y414)
- binding pyridoxal-5'-phosphate: G112 (= G108), S113 (= S109), Y144 (= Y141), H145 (= H142), D245 (= D247), I247 (= I249), K274 (= K276)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:412/425 of 4w1vA
- active site: Y18 (≠ C11), Y147 (= Y141), E210 (= E213), D244 (= D247), A247 (= A250), K273 (= K276), Y397 (= Y414)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P10), Y18 (≠ C11), W54 (= W48), M81 (≠ I75), G83 (≠ A77), Y147 (= Y141), G306 (≠ S311), P307 (≠ H312), T308 (≠ S313), F392 (≠ L409)
- binding pyridoxal-5'-phosphate: G114 (= G108), S115 (= S109), Y147 (= Y141), H148 (= H142), E210 (= E213), D244 (= D247), I246 (= I249), K273 (= K276)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:412/425 of 4cxrA
- active site: Y18 (≠ C11), Y147 (= Y141), E210 (= E213), D244 (= D247), A247 (= A250), K273 (= K276), Y397 (= Y414)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ C11), W54 (= W48), W55 (= W49), A216 (= A219)
- binding pyridoxal-5'-phosphate: G114 (= G108), S115 (= S109), Y147 (= Y141), H148 (= H142), E210 (= E213), D244 (= D247), I246 (= I249), K273 (= K276), P307 (≠ H312), T308 (≠ S313)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 13:406/417 of 3tfuA
- active site: Y19 (≠ C11), Y151 (= Y141), E204 (= E213), D238 (= D247), A241 (= A250), K267 (= K276), Y391 (= Y414)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W48), G118 (= G108), S119 (= S109), Y151 (= Y141), H152 (= H142), D238 (= D247), I240 (= I249), K267 (= K276), P301 (≠ H312), T302 (≠ S313)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
34% identity, 98% coverage: 6:437/441 of query aligns to 12:420/427 of 1mlzA
- active site: Y17 (≠ C11), Y144 (= Y141), E210 (= E213), D244 (= D247), A247 (= A250), K273 (= K276), Y397 (= Y414)
- binding pyridoxal-5'-phosphate: G112 (= G108), S113 (= S109), Y144 (= Y141), H145 (= H142), D244 (= D247), I246 (= I249), K273 (= K276), P307 (≠ H312), T308 (≠ S313)
- binding trans-amiclenomycin: W52 (= W48), W53 (= W49), Y144 (= Y141), K273 (= K276), R390 (= R407), F392 (≠ L409)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
34% identity, 98% coverage: 6:437/441 of query aligns to 12:420/427 of 1mlyA
- active site: Y17 (≠ C11), Y144 (= Y141), E210 (= E213), D244 (= D247), A247 (= A250), K273 (= K276), Y397 (= Y414)
- binding cis-amiclenomycin: W52 (= W48), W53 (= W49), K273 (= K276), R390 (= R407), F392 (≠ L409)
- binding pyridoxal-5'-phosphate: G112 (= G108), S113 (= S109), Y144 (= Y141), H145 (= H142), D244 (= D247), I246 (= I249), K273 (= K276), P307 (≠ H312), T308 (≠ S313)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 19:422/437 of P9WQ81
- Y25 (≠ C11) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W48) binding
- Y157 (= Y141) binding
- K283 (= K276) modified: N6-(pyridoxal phosphate)lysine
- G316 (≠ S311) binding
6ge8B Crystal structure of mycobacterium tuberculosis bioa
32% identity, 96% coverage: 5:429/441 of query aligns to 13:408/420 of 6ge8B
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: W58 (= W48), G118 (= G108), S119 (= S109), Y151 (= Y141), H152 (= H142), A212 (= A219), D240 (= D247), I242 (= I249), K269 (= K276), P303 (≠ H312), T304 (≠ S313)
- binding magnesium ion: H152 (= H142), G153 (= G143), A158 (= A148), C162 (= C152)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:415/429 of 5kgtA
- active site: Y18 (≠ C11), Y150 (= Y141), E213 (= E213), D247 (= D247), A250 (= A250), K276 (= K276), Y400 (= Y414)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I75), G86 (≠ A77), G309 (≠ S311), T311 (≠ S313)
- binding pyridoxal-5'-phosphate: S116 (≠ I107), G117 (= G108), S118 (= S109), Y150 (= Y141), H151 (= H142), G152 (= G143), E213 (= E213), D247 (= D247), I249 (= I249), K276 (= K276)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:415/429 of 5kgsA
- active site: Y18 (≠ C11), Y150 (= Y141), E213 (= E213), D247 (= D247), A250 (= A250), K276 (= K276), Y400 (= Y414)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P10), Y18 (≠ C11), W57 (= W48), M84 (≠ I75), G86 (≠ A77), Y150 (= Y141), D162 (≠ G153), G165 (vs. gap), G166 (≠ L156), P310 (≠ H312), T311 (≠ S313), F395 (≠ L409)
- binding pyridoxal-5'-phosphate: G117 (= G108), S118 (= S109), Y150 (= Y141), H151 (= H142), G152 (= G143), E213 (= E213), D247 (= D247), I249 (= I249), K276 (= K276)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
32% identity, 96% coverage: 5:429/441 of query aligns to 12:415/429 of 4xjpA
- active site: Y18 (≠ C11), Y150 (= Y141), E213 (= E213), D247 (= D247), A250 (= A250), K276 (= K276), Y400 (= Y414)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P10), Y18 (≠ C11), W57 (= W48), M84 (≠ I75), G86 (≠ A77), Y150 (= Y141), G165 (vs. gap), G166 (≠ L156), A219 (= A219), G220 (= G220), G309 (≠ S311), F395 (≠ L409)
- binding pyridoxal-5'-phosphate: G117 (= G108), S118 (= S109), Y150 (= Y141), H151 (= H142), G152 (= G143), E213 (= E213), D247 (= D247), I249 (= I249), K276 (= K276), P310 (≠ H312), T311 (≠ S313)
Query Sequence
>WP_013010405.1 NCBI__GCF_000025725.1:WP_013010405.1
MKPVTNIWHPCTQMKDHETYPIIKIERGEGIYLYDDKNNKYIDAVSSWWVNIFGHNNPRL
KDAIKNQLDKIEHVIFAGITHDPALKLTEQLLSVTPENLTKVFYADIGSAAVESAMKLSY
GYRKNNGVTSKKRYLYLDSGYHGETLGALSVCGEELYTELYGDIMIENIRVQGPDCYRCP
YGKTRNECSAQCFEHMERTIEKHANEITAVIIEPLLQCAGGMKMYPPLYLQKLCEAAKAY
DIHTIFDEIASGFGRTGTMFALEQAGVQPDFICVSKGLTSGYLPMSAVLTTDEIYSAFYD
DYTTLKAFLHSHSFTGNPLACAVANETMKMFKELNIIEENRKKFPVMHEYINKKFKGQPH
VGEIRHLGCVSAVELVKDVKTKESFDWKDRTGFQIFRKSITKGAYLRNLGDVIYFMPPYV
ITEDEMIKLVDIAHESIFEVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory