Comparing WP_013010470.1 NCBI__GCF_000025725.1:WP_013010470.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
39% identity, 98% coverage: 3:174/176 of query aligns to 4:192/194 of 1lbmA
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
38% identity, 98% coverage: 3:174/176 of query aligns to 4:203/205 of 1nsjA
>WP_013010470.1 NCBI__GCF_000025725.1:WP_013010470.1
MFVKICGIKTPEMAELACEHGADAIGVVAYKKSKRYVAPEQAKAIKNAINGRCPLVVVSV
SKEDCEPYASFADYVQADDANTSETQILSGSERPDGIFRYFLYDASRGAGLRSDYPDWIE
EYSDRLILAGGLDSDNVIDVIEKYKPFGVDVSSGVETDGEKDIEKIKVFINNAKTN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory