Comparing WP_013011985.1 NCBI__GCF_000025725.1:WP_013011985.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
44% identity, 93% coverage: 24:367/369 of query aligns to 19:356/358 of P45131
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
42% identity, 99% coverage: 2:366/369 of query aligns to 5:372/387 of Q6FEQ3
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
38% identity, 98% coverage: 5:366/369 of query aligns to 1:342/346 of 5w8oB
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
38% identity, 98% coverage: 10:369/369 of query aligns to 9:373/374 of D2Z028
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 75% coverage: 13:290/369 of query aligns to 84:359/504 of Q10341
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
36% identity, 95% coverage: 19:368/369 of query aligns to 19:349/350 of 2vavB
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
36% identity, 95% coverage: 19:368/369 of query aligns to 18:347/347 of 2vatA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
35% identity, 94% coverage: 21:366/369 of query aligns to 20:361/368 of 7rytB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
35% identity, 94% coverage: 21:366/369 of query aligns to 21:362/366 of 6puxA
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
35% identity, 94% coverage: 21:366/369 of query aligns to 20:361/367 of 8f2lA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
36% identity, 99% coverage: 3:366/369 of query aligns to 9:362/366 of 6ioiA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
36% identity, 99% coverage: 3:366/369 of query aligns to 9:362/375 of 6iohA
>WP_013011985.1 NCBI__GCF_000025725.1:WP_013011985.1
MSGSVGVVKTQFFTLKEEFFFESGRVLSSVTVAYETYGKLNEARDNAILVCHALTGNAHA
AGFNREDDQRPGWWDSMIGPGKAFDTDKYFVISSNFLGSCFGTTGPSSVDPQTKKRYGLK
FPVVTVRDMVKLQKKLIDHLGIEVLHSVAGGSMGGMQALEWGATFPYATKSIIPIAASAA
VTPMAIAFNAIAKFAIMKDPNWRGGDYYDDVAPLDGLAIARMAGHITYMSDASFHSKFGR
RYATFEGIYDFKGLFEVENYLRYNGYKFTEFYDPNTYLYVLKAMDIFELAYGRNGLKDAL
RLITSKALFITFTSDFLFPPYQTEELVTLMKEIGNEPRWENIESDYGHDAFLLEFEAQTE
IIKNFLSEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory