Comparing WP_013074944.1 NCBI__GCF_000092905.1:WP_013074944.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
44% identity, 90% coverage: 19:377/398 of query aligns to 10:361/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 17:397/398 of query aligns to 46:428/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 97% coverage: 7:392/398 of query aligns to 4:388/389 of 4ewtA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 94% coverage: 21:394/398 of query aligns to 54:429/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
36% identity, 79% coverage: 24:338/398 of query aligns to 24:341/398 of 6slfA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
22% identity, 78% coverage: 12:322/398 of query aligns to 2:318/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
22% identity, 77% coverage: 15:322/398 of query aligns to 1:314/377 of P44514
Sites not aligning to the query:
>WP_013074944.1 NCBI__GCF_000092905.1:WP_013074944.1
MAVLVAELEELAAAVKDDVVGWRRYLHAHPELSFQEENTAQFVYDTLRSFGGFELSRPTK
TSVVARLIGAAPGPVVAVRADMDALPIQEENDLPFASTNPGVMHACGHDGHTAMLLGAAR
ILSALRPRLRGEVRFLFQHAEELFPGGAQELVVLGIVDGVRAVIGAHLWIPLEVGKIGVK
AGELMASPDRFRIVIRGRGGHAAQPHMTVDSIAVGAQVVTNLQHIVSRYVDPLDRLVVSV
TRFMAGTADNVIPESAELWGTVRCFNPELRRQAPGWIERVVKGVTEAHGASYDMEYTHGY
RPVINDPAVTALLREGLEEVFGAEAVVDAVPTMGGEDFSAYQSRAAGSFFFIGAGNPDKG
ITFPHHHPRFTVDEDALPLGVKALVAGVMKLLAEGKSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory