SitesBLAST
Comparing WP_013075565.1 NCBI__GCF_000092905.1:WP_013075565.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
60% identity, 98% coverage: 1:339/346 of query aligns to 1:340/346 of Q04797
- S98 (= S98) modified: Phosphoserine
- Y146 (≠ F146) modified: Phosphotyrosine
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), A71 (= A74), T75 (= T78), G160 (= G163), M161 (≠ A164), G162 (≠ R165)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R101), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E218), K222 (= K221), R244 (= R243)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/361 of 3pylC
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G75), S73 (≠ A76), T94 (≠ S97), S95 (= S98), R98 (= R101), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), N93 (= N96), T94 (≠ S97), N126 (= N129), C127 (= C130), G160 (= G163), G328 (= G327)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S73), G72 (= G75), S73 (≠ A76), N93 (= N96), T94 (≠ S97), S95 (= S98), R98 (= R101), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), A71 (= A74), G160 (= G163), M161 (≠ A164), G162 (≠ R165)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 4r3nA
- active site: C127 (= C130), Q154 (= Q157), R244 (= R243), H251 (= H250)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ A76), T94 (≠ S97), S95 (= S98), R98 (= R101), N126 (= N129), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), N93 (= N96), T94 (≠ S97), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ A164), G328 (= G327)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R101), N126 (= N129), G158 (= G161), I208 (= I207), E219 (= E218), K222 (= K221), R244 (= R243)
- binding adenosine-2'-5'-diphosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), A71 (= A74), T75 (= T78), G160 (= G163), M161 (≠ A164)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), A71 (= A74), T75 (= T78), G160 (= G163)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R101), N126 (= N129), G158 (= G161), A159 (= A162), E219 (= E218), K222 (= K221), R244 (= R243)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 2gz3A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R243), H251 (= H250)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E218), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), N93 (= N96), G158 (= G161), G160 (= G163), M161 (≠ A164), N324 (= N323), A329 (= A328)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 2gz2A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R243), H251 (= H250)
- binding adenosine-2'-5'-diphosphate: G8 (= G11), T10 (= T13), G11 (= G14), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), A71 (= A74), T75 (= T78)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/357 of 2gz1A
- active site: C127 (= C130), Q154 (= Q157), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), N93 (= N96), S157 (= S160), G158 (= G161), G160 (= G163), M161 (≠ A164), N324 (= N323), L325 (= L324)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ A76), T94 (≠ S97), S95 (= S98), R98 (= R101), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), K222 (= K221), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), N93 (= N96), T94 (≠ S97), P125 (= P128), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ A164), G328 (= G327)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S97), S95 (= S98), R98 (= R101), N126 (= N129), C127 (= C130), Q154 (= Q157), G158 (= G161), E219 (= E218), K222 (= K221), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), N93 (= N96), T94 (≠ S97), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ A164), G328 (= G327)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R101), G158 (= G161), E219 (= E218), K222 (= K221), R244 (= R243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (= R41), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), T75 (= T78), C127 (= C130), S157 (= S160), G158 (= G161), G160 (= G163), M161 (≠ A164), N324 (= N323), L325 (= L324)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
55% identity, 99% coverage: 6:346/346 of query aligns to 3:347/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (= A15), V13 (= V16), A35 (= A38), S36 (= S39), S39 (= S42), T56 (≠ A59), S70 (= S73), A71 (= A74), G72 (= G75), N93 (= N96), T94 (≠ S97), N126 (= N129), C127 (= C130), G160 (= G163), M161 (≠ A164), G328 (= G327)
- binding phthalic acid: S73 (≠ A76), T94 (≠ S97), S95 (= S98), R98 (= R101), N126 (= N129), K222 (= K221)
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
54% identity, 98% coverage: 1:340/346 of query aligns to 1:333/337 of P23247
- C132 (= C130) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
53% identity, 98% coverage: 2:340/346 of query aligns to 1:332/336 of 2r00C
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
44% identity, 97% coverage: 5:339/346 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C130), Q156 (= Q157), R248 (= R243), H255 (= H250)
- binding cysteine: C129 (= C130), Q156 (= Q157), G160 (= G161), E223 (= E218), R248 (= R243), H255 (= H250)
- binding glycerol: S108 (≠ P111), G187 (≠ L188), F192 (≠ L193), P201 (vs. gap), Q225 (≠ M220), R228 (≠ V223), F229 (≠ N224), Q335 (= Q334), E338 (= E337), L339 (= L338)
- binding sulfate ion: R98 (= R101), H117 (≠ G120), R119 (= R122), N128 (= N129), C129 (= C130), K226 (= K221), E270 (= E265), R273 (≠ Y268)
1ys4A Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii (see paper)
31% identity, 98% coverage: 4:342/346 of query aligns to 2:346/348 of 1ys4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), T11 (= T13), G12 (= G14), S13 (≠ A15), V14 (= V16), A35 (≠ S39), S36 (= S40), S39 (= S42), L89 (≠ T78), N107 (= N96), S181 (= S160), G182 (= G161), A183 (= A162), G184 (= G163), N327 (= N323), T328 (≠ L324)
Query Sequence
>WP_013075565.1 NCBI__GCF_000092905.1:WP_013075565.1
MTEELTVAVVGATGAVGRKMIETLETRRFPVKTLVPMASSRSAGKSVTFRGENVTVLEAQ
PEAFKGVDIALFSAGAKTSRALSPEAARRGAVVIDNSSAFRMDPEVPLVVPEVNGRAALG
HRGIIANPNCSTIQMVVALKPIYDRFGIERIIVSTYQAVSGAGARAVEELMTLTRSQLSG
EKRPAEILPVSSLPVHHSIAFNVLPQIDVFEDNGFTKEEMKMVNETRKILDDPEILVSPT
CVRVPVVTGHSEAVYVETEEPFELEDIYGVLEHAPGVVVLDDPASQKYPMPADTEGRPEV
FVGRIRKDLGHPRGLNLWVVSDNLLKGAAYNAVQIAELLVEQGGLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory