Comparing WP_013075814.1 NCBI__GCF_000092905.1:WP_013075814.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
45% identity, 95% coverage: 10:430/444 of query aligns to 18:444/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 95% coverage: 10:430/444 of query aligns to 19:445/447 of P9WIU7
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
46% identity, 95% coverage: 10:430/444 of query aligns to 20:442/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
46% identity, 95% coverage: 10:430/444 of query aligns to 20:442/442 of 5x7nA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
37% identity, 95% coverage: 13:436/444 of query aligns to 12:433/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
37% identity, 95% coverage: 13:436/444 of query aligns to 12:433/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
37% identity, 95% coverage: 13:436/444 of query aligns to 16:437/438 of Q58497
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
36% identity, 91% coverage: 24:428/444 of query aligns to 5:381/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 91% coverage: 24:428/444 of query aligns to 6:382/386 of Q9X1K5
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
31% identity, 92% coverage: 24:431/444 of query aligns to 6:399/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
31% identity, 92% coverage: 24:431/444 of query aligns to 4:391/394 of 3c5qA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
32% identity, 95% coverage: 10:432/444 of query aligns to 7:415/418 of 4xg1B
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
31% identity, 92% coverage: 21:429/444 of query aligns to 22:418/422 of 6n2aA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
26% identity, 93% coverage: 15:427/444 of query aligns to 1:407/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
28% identity, 96% coverage: 5:430/444 of query aligns to 19:455/461 of 8d5rA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
28% identity, 96% coverage: 5:430/444 of query aligns to 18:453/458 of 8d5dA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
28% identity, 96% coverage: 5:430/444 of query aligns to 19:457/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
28% identity, 96% coverage: 5:430/444 of query aligns to 19:457/462 of 8d4iA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
29% identity, 95% coverage: 10:432/444 of query aligns to 4:390/393 of 4xg1A
1knwA Crystal structure of diaminopimelate decarboxylase
28% identity, 91% coverage: 21:423/444 of query aligns to 15:410/421 of 1knwA
>WP_013075814.1 NCBI__GCF_000092905.1:WP_013075814.1
MPSLGTRRVNDRGHLEIGGCDTVELAERFGTPLYVFDEVLLRETCREFHAAFRKAGLRYQ
VAYAGKAFCTQAMCRLVEEEGLHLDVVSAGELHTALTAGFPPEKIHLHGNNKSRDELIYG
LRAGIGGFVVDNFYELDLLAELAERQGKRPNILLRVTPGVEAHTHEYIQTGQQDTKFGFD
LASGQAEAAVRRAQRARGVNLVGLHCHIGSQIFETEGFVLAVERMMEFYARAVNEWGASL
RILNVGGGFGIRYVEEDRPLPVEAYIAAIADAVKGEALRRGVAVPEVWVEPGRRIAGPAG
TTLYTVGARKEIPGVRRYIAVDGGMADNPRPIIYQARYEAVVANRAGEPVEELAAVAGKF
CETGDMLIWDTPLARAVPGDILAVFGTGAYTYSMASNYNRAPRPAVVFVRDGRADVVVRR
ETLDDLIRLDQIPERMRKEQHPVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory