Comparing WP_013076055.1 NCBI__GCF_000092905.1:WP_013076055.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
53% identity, 96% coverage: 1:377/393 of query aligns to 1:377/377 of 7d7oB
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
52% identity, 96% coverage: 1:377/393 of query aligns to 1:371/373 of 4l0oH
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
49% identity, 95% coverage: 5:376/393 of query aligns to 5:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
49% identity, 95% coverage: 5:376/393 of query aligns to 5:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
49% identity, 95% coverage: 5:376/393 of query aligns to 5:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
49% identity, 95% coverage: 5:376/393 of query aligns to 5:377/380 of 7mcqA
7mcbH Crystal structure of staphylococcus aureus cystathionine gamma lyase holoenzyme (see paper)
49% identity, 95% coverage: 5:376/393 of query aligns to 5:377/380 of 7mcbH
Sites not aligning to the query:
6ldoA Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
47% identity, 96% coverage: 1:377/393 of query aligns to 1:376/381 of 6ldoA
6le4A Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with cystathionine (see paper)
47% identity, 96% coverage: 1:377/393 of query aligns to 1:376/380 of 6le4A
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 2:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 2:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 2:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 2:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 2:380/381 of 4ixzA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
49% identity, 95% coverage: 5:377/393 of query aligns to 9:372/377 of 7ba4A
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 3:381/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
49% identity, 96% coverage: 1:376/393 of query aligns to 3:381/382 of 6k1lA
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
48% identity, 95% coverage: 3:376/393 of query aligns to 4:380/381 of 6cjaA
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
47% identity, 92% coverage: 17:379/393 of query aligns to 24:388/390 of 8j6nA
4ixsB Native structure of xometc at ph 5.2 (see paper)
48% identity, 96% coverage: 1:376/393 of query aligns to 1:371/372 of 4ixsB
>WP_013076055.1 NCBI__GCF_000092905.1:WP_013076055.1
MRIDTRCSQAGNRRDPTTGAISLPIHHATTYAHPGLGSSTGFDYTRTSNPTRLALEETIA
ALHGGCRGFAFASGMAAIDAIARLFRPGDHLVLSDDLYGGTYRLFERFFRPLGLETTYVD
TSDLQAVAKQIRPRTRALFVETPTNPTLKIADLKGLSQVAHERGLWLIVDNTFMTPYLQR
PLELGADIVVESATKYLGGHNDVLAGTVVVKSEALANSLAFIQNSIGAVLGPQDAWLLLR
GIKTLHVRMDRHEGNARTLAEWLRAHPRVSRVYYPGLPDHPGHAVHRAQASGWGGMIAFE
VPNNRWVPPILAHLRVITFAESLGGTESLITYPAVQTHADVPPDVRQRLGVTDSLLRLSV
GLEHVDDLIQDLDQALALAANARAEESAPKVTC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory