SitesBLAST
Comparing WP_013076160.1 NCBI__GCF_000092905.1:WP_013076160.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
59% identity, 98% coverage: 5:315/318 of query aligns to 2:312/315 of Q51742
- W22 (≠ R25) mutation to A: Decreased heat stability.
- E26 (≠ R29) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ V33) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ K37) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y231) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ R244) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E281) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
52% identity, 96% coverage: 8:311/318 of query aligns to 9:307/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
52% identity, 96% coverage: 8:311/318 of query aligns to 5:303/307 of 4nf2A
- active site: R55 (= R62), T56 (= T63), R83 (= R90), R104 (= R111), H131 (= H138), Q134 (= Q141), D226 (= D233), C265 (= C273), R293 (= R301)
- binding phosphoric acid mono(formamide)ester: S53 (= S60), T54 (= T61), R55 (= R62), T56 (= T63), R104 (= R111), H131 (= H138), Q134 (= Q141), C265 (= C273), L266 (= L274), R293 (= R301)
- binding norvaline: L126 (= L133), N162 (= N169), D226 (= D233), S230 (= S237), M231 (= M238)
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
50% identity, 94% coverage: 11:310/318 of query aligns to 2:299/304 of 8qeuA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
46% identity, 98% coverage: 3:314/318 of query aligns to 32:343/354 of P00481
- R92 (= R62) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C273) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
46% identity, 98% coverage: 3:314/318 of query aligns to 32:343/354 of P00480
- G39 (= G10) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R11) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L14) to F: in dbSNP:rs72554309
- K46 (≠ A17) to R: in dbSNP:rs1800321
- Y55 (≠ G26) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L34) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K58) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 60:63) binding
- G100 (= G70) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M71) to L: in dbSNP:rs1133135
- L111 (= L81) to P: in dbSNP:rs1800324
- T125 (≠ P95) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D96) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (= R99) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I110) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R111) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H138) binding
- Q171 (= Q141) binding
- I172 (≠ V142) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ A146) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TI 148:149) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ K153) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G158) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G165) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D166) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A171) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ G177) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ P179) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (= M183) to K: in OTCD; late onset
- H214 (≠ N184) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P190) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (≠ C195) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ M214) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T232) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V234) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W235) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G239) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (= Q240) to R: in dbSNP:rs1800328
- E272 (≠ A242) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R247) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H272) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C273) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 273:274) binding
- E309 (= E280) natural variant: Missing (in OTCD; late onset)
- R330 (= R301) binding
- T333 (≠ A304) natural variant: T -> A
- S340 (≠ A311) to P: in OTCD; late onset; dbSNP:rs72558489
- T343 (≠ A314) to K: in OTCD; late onset; dbSNP:rs72558491
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
48% identity, 94% coverage: 11:310/318 of query aligns to 2:292/297 of 8qevA
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
46% identity, 97% coverage: 6:314/318 of query aligns to 2:310/321 of 1othA
- active site: R59 (= R62), T60 (= T63), V87 (≠ R90), R108 (= R111), H135 (= H138), Q138 (= Q141), D230 (= D233), C270 (= C273), R297 (= R301)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S60), T58 (= T61), R59 (= R62), T60 (= T63), R108 (= R111), L130 (= L133), H135 (= H138), N166 (= N169), D230 (= D233), S234 (= S237), M235 (= M238), C270 (= C273), L271 (= L274), R297 (= R301)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
46% identity, 97% coverage: 6:314/318 of query aligns to 2:310/321 of 1c9yA
- active site: R59 (= R62), T60 (= T63), V87 (≠ R90), R108 (= R111), H135 (= H138), Q138 (= Q141), D230 (= D233), C270 (= C273), R297 (= R301)
- binding phosphoric acid mono(formamide)ester: S57 (= S60), T58 (= T61), R59 (= R62), T60 (= T63), R108 (= R111), C270 (= C273), L271 (= L274), R297 (= R301)
- binding norvaline: L130 (= L133), N166 (= N169), D230 (= D233), S234 (= S237), M235 (= M238)
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7nouA
- active site: R102 (= R111), H129 (= H138), Q132 (= Q141), D225 (= D233), C265 (= C273), R293 (= R301)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I55), T52 (= T61), R53 (= R62), R53 (= R62), F56 (≠ V65), F56 (≠ V65), L79 (= L88), D82 (≠ G91), E83 (= E92), V91 (= V100), Y95 (= Y104), L266 (= L274), R293 (= R301)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7nnyA
- active site: R102 (= R111), H129 (= H138), Q132 (= Q141), D225 (= D233), C265 (= C273), R293 (= R301)
- binding 1-naphthol: T52 (= T61), R53 (= R62), F56 (≠ V65), E83 (= E92), V91 (= V100), Y95 (= Y104)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7nnwA
- active site: R102 (= R111), H129 (= H138), Q132 (= Q141), D225 (= D233), C265 (= C273), R293 (= R301)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I55), T52 (= T61), R53 (= R62), F56 (≠ V65), L79 (= L88), L92 (= L101), Y95 (= Y104)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
51% identity, 94% coverage: 11:310/318 of query aligns to 4:302/308 of 7nnvA
- active site: R102 (= R111), H129 (= H138), Q132 (= Q141), D225 (= D233), C265 (= C273), R293 (= R301)
- binding phosphoric acid mono(formamide)ester: S51 (= S60), T52 (= T61), R53 (= R62), T54 (= T63), R102 (= R111), H129 (= H138), C265 (= C273), L266 (= L274), R293 (= R301)
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
51% identity, 94% coverage: 11:310/318 of query aligns to 3:301/307 of 2i6uA
- active site: R52 (= R62), T53 (= T63), R80 (= R90), R101 (= R111), H128 (= H138), Q131 (= Q141), D224 (= D233), C264 (= C273), R292 (= R301)
- binding phosphoric acid mono(formamide)ester: S50 (= S60), T51 (= T61), R52 (= R62), T53 (= T63), R101 (= R111), C264 (= C273), L265 (= L274), R292 (= R301)
- binding norvaline: L123 (= L133), N160 (= N169), D224 (= D233), S228 (= S237), M229 (= M238)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
51% identity, 94% coverage: 11:310/318 of query aligns to 3:301/307 of P9WIT9
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
50% identity, 94% coverage: 11:310/318 of query aligns to 4:299/305 of 7np0A
4jfrB Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate
41% identity, 97% coverage: 6:313/318 of query aligns to 9:338/340 of 4jfrB
- active site: R65 (= R62), T66 (= T63), D93 (≠ R90), R114 (= R111), H141 (= H138), Q144 (= Q141), D239 (= D233), C281 (= C273), R326 (= R301)
- binding phosphoric acid mono(formamide)ester: S63 (= S60), T64 (= T61), R65 (= R62), T66 (= T63), R114 (= R111), H141 (= H138), Q144 (= Q141), C281 (= C273), R326 (= R301)
4jqoA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
41% identity, 97% coverage: 6:313/318 of query aligns to 7:336/338 of 4jqoA
- active site: R63 (= R62), T64 (= T63), D91 (≠ R90), R112 (= R111), H139 (= H138), Q142 (= Q141), D237 (= D233), C279 (= C273), R324 (= R301)
- binding citrulline: H139 (= H138), Q142 (= Q141), N173 (= N169), D237 (= D233), S241 (= S237), M242 (= M238), C279 (= C273), L280 (= L274), R324 (= R301)
Query Sequence
>WP_013076160.1 NCBI__GCF_000092905.1:WP_013076160.1
MAEGTIDLRGRDFLDLADFTSDELRGLLRLAAVLKEKQKAGERVQPLAGKTLGMIFEKSS
TRTRVSFEVGMVQLGGHALFLASHDTQLGRGEPIPDTARVLSRYVDGIMIRTFSHESVRE
LAEYATVPVINGLTDLHHPCQVLADAMTILEHKSRLEGVTVAYVGDGNNMANSWLVGAPL
FGMNLRVATPQGYECDPGVAARAQELAARAGTEMSLVHDPREAVAGADVIYTDVWASMGQ
EAEREERLRAFAGFEVTPALVARAAPDYLFMHCLPAHRGEEVAPDVIDGPHSVIFDEAEN
RLHAQKAILVATMAGPLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory